SecReT4
Protein ID: 269124264
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p29
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]24489..25421 [+]
ProductAM30
Component typeOrf12_p
UniProt IDQ9AL07
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 310 a.a.     [Download]
>gi|269124264|ref|YP_003305374.1| AM30 [Enterococcus faecalis]
MDVIDQIKDTGSDILSSAGEAISNVFEGVKESVDSVLHPIDTLLGNWGSDLLEASMKIANKTTFDIPNIE
LISTITNVFVFATTTFAICIVLYKVIEAQIQASNGSGDALTANIVQKLFYSSIALATLPWAMNFFIKKIV
APIGEYVIQQVANDLNVETIGERLRNFLVSNFFNGGVSAVVLFVFVIFFAFSIAKYFVAICVFYADFLVL
TMLTPLVALSLLTDEQNYFQIWIKELLSEALTMLIKLILYLLMITLMIAEKYTLPNFMLMVGCGLLIIKT
PSALQNMWYSTKVSKGGGLGNLAMMAMFRK
 
Nucleotide Sequence: 933 bp     [Download]
>gi|269124235|ref|NC_013514.1|:24489-25421 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGGACGTAATAGACCAAATAAAAGATACAGGATCGGATATTTTAAGTTCTGCTGGTGAGGCTATCTCTA
ATGTCTTTGAGGGCGTAAAAGAGAGTGTGGATAGTGTATTGCACCCTATTGATACCTTGTTAGGGAATTG
GGGCAGTGACCTTTTAGAAGCCAGTATGAAAATTGCCAATAAGACGACTTTTGATATTCCCAATATCGAA
TTAATTAGTACCATTACCAATGTGTTTGTCTTTGCAACGACAACCTTTGCGATTTGTATTGTGTTGTATA
AGGTCATTGAAGCGCAAATACAAGCTTCTAATGGGAGTGGTGACGCATTGACCGCTAATATTGTTCAAAA
GCTGTTTTACTCGTCTATTGCCTTAGCAACGTTGCCCTGGGCAATGAACTTTTTTATCAAAAAGATTGTT
GCACCGATCGGGGAATATGTGATTCAACAAGTCGCTAATGATTTGAACGTGGAAACGATCGGCGAACGTT
TGCGTAATTTCTTAGTTTCCAATTTCTTTAATGGTGGCGTTAGTGCCGTTGTTCTCTTTGTTTTTGTGAT
CTTCTTTGCCTTTTCCATTGCCAAGTATTTTGTAGCGATCTGTGTCTTTTATGCCGATTTCTTGGTACTG
ACTATGTTAACACCATTAGTTGCCTTATCGCTTTTAACAGACGAACAAAATTACTTTCAAATATGGATCA
AAGAACTGTTATCCGAAGCACTCACAATGCTTATTAAGCTTATTTTGTACTTACTCATGATTACACTCAT
GATTGCTGAAAAATACACGTTACCAAACTTTATGTTAATGGTTGGTTGTGGCTTGTTGATTATCAAAACA
CCGTCAGCCCTACAAAATATGTGGTATTCAACCAAAGTGTCAAAAGGTGGCGGACTTGGAAACTTAGCAA
TGATGGCTATGTTTAGAAAATAA
 Primer design