SecReT4
Protein ID: 269124265
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p30
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]25618..26409 [+]
ProductAM31
Component typeOrf13_p
UniProt IDD1MAW7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.3e-07, Aligned region: 162..257
Protein Sequence: 263 a.a.     [Download]
>gi|269124265|ref|YP_003305375.1| AM31 [Enterococcus faecalis]
MSVTLNTKNTKETDVINLLLNRVTDQHVLVYLNEPTEPTTLNTQELNRQELKTSNERQEIPQTEIPTETV
NEPSVIKEISKKNQAKQTNSRKESLSESITKKNVPRIHLFISILTLFIVLLIGISVIQQVQLQSVKKESE
LLEEQIERVKETDISQSKIDTFGRYFLTYYFSQEKNQENYQSSLRTYVSEKVDISDWKALGKTLKSVNYY
GSEQTKKGYSVEYLLNVSVDNRSKMQKITFEVEPTKNGFLVTTQPKLTDFSFN
 
Nucleotide Sequence: 792 bp     [Download]
>gi|269124235|ref|NC_013514.1|:25618-26409 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGTCTGTTACGCTGAATACAAAAAATACCAAAGAAACGGACGTAATTAACTTGTTATTAAATCGAGTAA
CAGATCAACACGTTTTAGTTTACTTGAATGAACCAACAGAACCAACAACGCTTAATACGCAAGAATTAAA
TCGTCAGGAGTTAAAAACGAGTAATGAACGCCAAGAAATACCGCAGACAGAAATTCCAACTGAAACAGTA
AATGAACCTAGTGTTATTAAGGAAATATCGAAAAAGAACCAAGCAAAACAAACGAATAGTAGAAAAGAAT
CACTATCAGAATCCATAACCAAGAAAAATGTTCCCAGAATTCATTTGTTCATATCTATTTTGACTCTTTT
TATTGTATTATTGATAGGAATAAGTGTTATTCAACAAGTACAACTTCAATCAGTCAAAAAAGAGAGCGAA
TTATTGGAAGAACAAATTGAACGTGTCAAAGAAACGGATATTTCTCAATCGAAAATAGATACTTTTGGAA
GATACTTTTTGACTTACTATTTTTCACAGGAAAAAAATCAAGAAAATTATCAGTCAAGTTTAAGAACATA
TGTATCCGAAAAGGTAGATATATCCGATTGGAAAGCGTTAGGGAAAACGCTTAAGAGTGTCAATTACTAT
GGTAGTGAACAAACAAAAAAAGGGTATAGCGTTGAATACCTTCTAAATGTTTCAGTAGACAATCGTAGTA
AAATGCAAAAAATCACTTTTGAGGTTGAACCAACTAAAAACGGCTTTCTTGTGACAACTCAACCAAAACT
TACAGACTTCTCTTTTAACTGA
 Primer design