SecReT4
Protein ID: 269124267
T4SS name [ID]Tra_p [639]
Gene symbol-
Locus tagpAMbeta1_p32
StrainEnterococcus faecalis plasmid pAMbeta1 (NC_013514)
Repliconplasmid pAMbeta1 [GenBank: NC_013514] [Browse all T4SS(s) in this replicon]
Location [Strand]26866..27714 [+]
ProductAM33
Component typeOrf15_p
UniProt IDD1MAW9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Gram_pos_anchor [PF00746], Evalue: 1.5e-10, Aligned region: 246..281
Protein Sequence: 282 a.a.     [Download]
>gi|269124267|ref|YP_003305377.1| AM33 [Enterococcus faecalis]
MKKIALLTLFSTALLVSAPLVSFADEATGSSGVNVLADDVVDPVEPTDPTTPVDPVDPVDPVDPVDPVDP
VDPVDPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPT
EPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPTEPSKPTEPTEPSKPVDTNPIENPVNTDTGVVIVAVED
SKPIIQLADGTTKKVEAKEIGADVQKDGTVTVKGSDGKMKVLPKTGETENIALSVLGSLMVLGSAFIFKK
RI
 
Nucleotide Sequence: 849 bp     [Download]
>gi|269124235|ref|NC_013514.1|:26866-27714 Enterococcus faecalis plasmid pAMbeta1, complete sequence
ATGAAAAAAATTGCCCTTTTAACACTTTTTAGTACAGCGCTATTGGTATCAGCCCCACTTGTTAGTTTTG
CGGACGAAGCAACAGGTAGTTCAGGTGTCAATGTTCTAGCTGATGATGTAGTTGATCCAGTAGAACCAAC
CGATCCAACTACTCCGGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCAGTTGATCCAGTCGATCCA
GTTGATCCAGTCGATCCAACAGAGCCAACGGAACCAACAGAGCCAACGGAACCAACAGAGCCAACGGAAC
CAACAGAGCCAACAGAGCCAACGGAACCAACGGAACCAACGGAACCAACGGAACCAACAGAGCCAACGGA
ACCAACGGAACCAACAGAGCCAACGGAACCAACAGAGCCAACGGAACCAACGGAACCAACAGAGCCAACA
GAGCCAACGGAACCAACGGAACCAACAGAGCCAACGGAACCAACAGAGCCAACAGAGCCAACAGAGCCAA
CGGAACCAACGGAGCCAACGGAACCAACGGAACCAAGCAAGCCGACAGAGCCAACAGAACCAAGTAAACC
AGTAGACACAAACCCAATCGAAAACCCAGTTAATACAGATACAGGCGTTGTGATTGTTGCAGTTGAAGAT
AGTAAACCAATCATTCAATTAGCAGACGGAACAACAAAAAAAGTTGAAGCTAAAGAAATTGGCGCAGACG
TTCAAAAAGACGGAACAGTAACGGTTAAAGGTTCAGACGGAAAAATGAAAGTTTTACCAAAAACAGGAGA
AACAGAAAATATTGCATTGTCTGTCCTAGGTTCATTAATGGTATTAGGATCAGCATTCATTTTTAAAAAG
AGAATCTAA
 Primer design