SecReT4
Protein ID: 269203322
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1694
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1749551..1751482 [-]
Producttransposon-related protein
Component typeYddG
UniProt IDD0K5S5
KEGG IDsad:SAAV_1694
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 643 a.a.     [Download]
>gi|269203322|ref|YP_003282591.1| conserved hypothetical protein, transposon-related protein [Staphylococcus aureus subsp. aureus ED98]
MKRKSLYLLCFLILPLCLVMGATAYAVANPVGQPTNAVNAKIEKYKVDNKADGDIDLDRYRALFHKESDW
NPFGKDEVAETVNNVTNFFFEINKLIVSITDYGIENLYQLDVLDDFADKIGQFVGDIYQKLLSNIVMTLF
IIICLNAFIIYSVKGNMAEALKRGFLIFCLIGFGVGVLANASFIIKGTNNVGKGLNNVIMNSTSAINGNV
DYVNENSGINKIRNQYFDMTLYKPYLIMNYGTVNEEAIKKKDNKRINDILDIKVKDKDTQGKRDDRVKDE
VTKHDNSAMKQSRVFAQLGIAMFTLIITISVSVIFLAISFAKVIFSAFALFLFLFLVFSWLLSFLPNLEL
SVFKALARTLGYIILSTCVSFLFVVIGLSIDIADAVIKPESQQAYFLNVIFLMIVLFVLYKKRREIIDFV
TRGNLSLSPQTIGEETIKKGQDEWNKRRKKQSEDKQQKRENQRDKPMPVFIVNQDDNNKPKRNQQQEVSH
STTPNQNIKRRNQQEEMHMSSNSDGPNTSSRHDLQKSKQSQEDQGLQREVKRNTEIKRNPQQDMSNYSNL
SRPPKEISRTSQTPNELSSNTREVQSSYDKDIEKRRIQNHQTHQNQHHSNTNGDQYRRSAQHNNKNEAEK
RLKEQKDISKHGK
 
Nucleotide Sequence: 1932 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1751482-1749551 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGAAGCGTAAAAGTTTATATCTTTTATGCTTTTTAATTTTGCCTCTGTGTCTTGTCATGGGGGCAACGG
CTTATGCGGTTGCTAATCCAGTAGGACAACCGACAAATGCGGTTAATGCGAAAATTGAAAAGTATAAAGT
GGATAATAAAGCCGATGGTGATATTGATTTAGATCGATATCGTGCCCTCTTTCATAAAGAATCAGATTGG
AACCCATTTGGCAAAGATGAAGTAGCTGAGACAGTTAATAATGTGACAAATTTTTTCTTTGAGATTAATA
AATTGATTGTAAGTATCACTGATTACGGTATAGAGAATTTATATCAATTGGATGTATTAGATGATTTCGC
AGATAAAATTGGTCAATTTGTGGGTGATATTTACCAAAAGTTATTAAGTAATATTGTGATGACATTGTTT
ATTATTATTTGTTTGAACGCGTTTATTATTTACTCTGTTAAAGGTAATATGGCAGAGGCATTAAAACGTG
GTTTCTTAATCTTTTGTTTAATTGGCTTTGGTGTGGGTGTGCTTGCGAATGCAAGTTTTATTATTAAAGG
TACAAACAATGTCGGTAAAGGGCTCAATAATGTCATTATGAATAGTACAAGCGCAATTAATGGCAATGTC
GATTATGTGAATGAAAATTCAGGGATAAATAAAATCCGTAATCAATATTTTGACATGACATTATATAAAC
CTTATTTGATTATGAATTATGGTACTGTAAATGAAGAAGCAATCAAAAAGAAAGATAACAAGCGTATTAA
TGATATTTTAGATATTAAAGTTAAAGATAAAGATACACAAGGAAAGCGAGATGATAGAGTTAAAGACGAA
GTTACTAAACATGATAATAGTGCTATGAAACAAAGTCGTGTGTTTGCGCAGCTTGGTATTGCGATGTTTA
CATTAATTATTACAATTTCTGTATCTGTGATTTTCCTTGCGATTAGTTTTGCGAAAGTCATATTTTCAGC
TTTCGCCCTATTTCTATTCTTATTTCTAGTGTTTAGTTGGCTATTAAGCTTTTTACCTAATTTAGAATTA
TCTGTATTTAAAGCGTTAGCGCGTACATTAGGTTATATTATTTTAAGTACGTGTGTATCGTTTTTATTTG
TGGTAATTGGCTTAAGTATTGATATTGCGGACGCAGTTATTAAACCGGAAAGCCAACAGGCTTATTTTTT
AAACGTGATTTTCTTAATGATTGTTTTGTTTGTATTGTATAAAAAGCGACGTGAAATCATTGATTTTGTG
ACACGTGGTAATTTGAGCTTATCACCTCAAACGATTGGTGAAGAGACAATCAAGAAAGGACAAGATGAAT
GGAATAAGCGACGTAAAAAGCAGTCTGAAGATAAACAACAAAAGCGTGAAAATCAACGTGATAAGCCAAT
GCCTGTATTTATTGTAAATCAAGATGATAATAACAAACCCAAGCGGAATCAACAACAAGAAGTATCACAT
TCAACAACGCCTAATCAAAATATTAAACGACGTAATCAACAAGAAGAGATGCATATGTCATCAAATTCAG
ATGGTCCTAATACATCATCGCGTCATGATTTACAGAAATCGAAACAATCACAAGAAGATCAAGGTTTACA
ACGTGAAGTAAAACGAAATACGGAGATTAAACGCAACCCTCAACAAGATATGTCCAATTATTCTAATTTA
TCAAGACCACCCAAAGAGATATCACGCACGAGTCAAACGCCGAATGAATTAAGCTCAAATACAAGAGAAG
TTCAATCATCTTACGATAAAGATATTGAAAAACGACGTATTCAAAATCATCAAACGCATCAAAATCAACA
TCATTCAAATACAAATGGCGATCAATATAGACGTAGCGCACAGCATAATAATAAAAACGAGGCAGAAAAG
CGATTAAAAGAACAAAAGGACATTAGTAAACATGGTAAATAA
 Primer design