SecReT4
Protein ID: 269203325
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1697
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1751928..1753289 [-]
Productftsk/spoiiie family protein
Component typeYdcQ
UniProt IDD0K5S8
KEGG IDsad:SAAV_1697
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 5e-24, Aligned region: 212..369
AAA_10 [PF12846], Evalue: 9.3e-09, Aligned region: 223..262
DUF87 [PF01935], Evalue: 4.1e-05, Aligned region: 224..334
Protein Sequence: 453 a.a.     [Download]
>gi|269203325|ref|YP_003282594.1| ftsk/spoiiie family protein [Staphylococcus aureus subsp. aureus ED98]
MAMNEIALFKGVRIQPYFKHIDFIFAGVFAFIFLAYRILTLWQDYIRQQKALNVVEVYQYFKPHFLYLVI
GTAIVFLIAKLFSQFVLRFREKDLAEMIETQGFHNRTVIKKTTEYLDIDYKKTEYDYYPTLFYKRKRKSF
MIHVKKDGSRFQDHYLELEQIIEPMFNCELVEKRHIGRFLRYEFMPLKYKKRIVMEGTEAPETTYYDTKI
YITHQILWDFVKAPHALITGVTGGGKTYFLFYMIRELFKRNAEVRLLDPKVSDLSFMKNVIGTEKVADTT
GQIFKQLREANEEMERRFRMMSESEHYKLGSNFRNFDLPPYFVIFDEVTAFTSTLDKKELQEMNDYLINI
IMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSMGNLSADGYRMTFGQTDKVFQPIHESDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKER
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1753289-1751928 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGGCAATGAATGAGATTGCTTTATTTAAAGGTGTGCGTATTCAACCGTATTTTAAACATATTGATTTTA
TCTTTGCGGGTGTGTTCGCATTTATCTTTTTAGCATATCGAATATTAACATTATGGCAAGATTATATTAG
ACAACAAAAAGCGTTAAATGTGGTTGAAGTATATCAGTACTTTAAACCACATTTTTTATATCTTGTGATT
GGTACAGCGATTGTGTTTTTAATTGCGAAATTATTTTCACAATTTGTTTTAAGATTTCGCGAAAAAGATT
TAGCTGAAATGATTGAAACCCAAGGTTTCCATAATCGTACAGTTATAAAGAAGACAACAGAGTACTTAGA
TATTGATTATAAGAAGACAGAATATGACTACTACCCTACGTTATTTTATAAGCGTAAACGTAAATCATTT
ATGATACATGTAAAGAAAGACGGTTCACGTTTCCAAGATCATTATTTAGAGTTGGAACAAATCATCGAAC
CAATGTTTAACTGTGAGCTTGTTGAGAAGCGTCATATTGGACGTTTCCTCAGATATGAGTTTATGCCTCT
TAAATATAAAAAACGTATCGTTATGGAAGGCACAGAGGCACCAGAGACGACTTATTACGATACAAAGATT
TATATTACGCATCAAATCCTTTGGGATTTTGTGAAAGCACCACATGCATTAATTACAGGTGTAACGGGTG
GTGGTAAAACATACTTTTTATTTTACATGATTAGGGAGTTATTTAAACGTAATGCAGAAGTGCGATTATT
AGACCCGAAAGTATCTGATTTATCATTTATGAAAAATGTGATTGGCACTGAAAAAGTGGCAGATACAACC
GGACAAATTTTTAAACAACTTAGAGAAGCAAATGAAGAAATGGAACGCCGTTTTAGAATGATGAGTGAAA
GCGAACATTATAAATTAGGTAGTAATTTCAGAAATTTCGACTTACCACCCTACTTTGTGATTTTTGATGA
AGTGACAGCGTTCACTTCTACTTTAGATAAAAAAGAACTTCAAGAAATGAATGATTATTTAATCAACATC
ATTATGAAAGGTCGTCAAGCTGGCGTATTCATGTTTTTAACAGCACAACGACCAGACGCAGATGTGATTA
AAGGTAATGTACGTGACCAATTAGGCTTGCGTGTATCAATGGGTAATTTGTCAGCTGATGGTTACCGTAT
GACCTTTGGTCAAACAGATAAAGTATTCCAACCTATTCATGAGTCAGATATTGGACGTGGTTACATTTCG
ATATTGGGACAATATAATGAACCGATTTTATTTGATGCGCCACTCATGGAACAATATGACTTTGTAGAAG
ATGTGAAACAAATATTAAATAAGGAGCGATAA
 Primer design