SecReT4
Protein ID: 269203329
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1701
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1754087..1756582 [-]
Producttransposon-related protein
Component typeYddE
UniProt IDD0K5T2
KEGG IDsad:SAAV_1701
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 4.1e-23, Aligned region: 460..764
DUF87 [PF01935], Evalue: 2e-05, Aligned region: 460..658
Protein Sequence: 831 a.a.     [Download]
>gi|269203329|ref|YP_003282598.1| conserved hypothetical protein, transposon-related protein [Staphylococcus aureus subsp. aureus ED98]
MDLKAPYAGIKNNLLLTKNGEVWAYYRIRSESISTANYDAKEASKKRMKYFLESIKGYQDFHFEMYEHDL
DLRNKFKEISKDFDDTTFDVANYYAQETIDVLEQELQMITHNSFVMGVKLRELSDDAVSIKEMVKSTLSD
TAERMISNLGFNVSLDDKVLSRYESFERELADNFLSIEGERLTENELAYIVRKPFISNATHDVQEESARR
AVTDVCNVVIDPTQMRVLKVTNENETFYTTTVVVDDFPLDMEYTHIFEKAQNMPFPVECHIKAKIVENDK
VKKKFDRAKINHKAQSREKQATGDNASEEIQDNLFVLEQMEKEVTGSGVFMEWSCLFVIKSDDLRDCKRK
AKRLVKRLKETEIYAVNPLADQLQLYYQVLHGNDLFINKYWVQRTTATGIAENLFGVSQSLGTKTGFYIG
RIDKFIRSVSREEAVASSRDIILFSLLLAAKGIKGAVSDSPHVLITGQTGKGKSFLAKLLWLYTSFFKGQ
MIYWDPKSEFADWFNKITESEEMRRKYPLFVSHLETFKYVTLDYNKSNNFGCLDPIVFLNGIEANEMLKS
VFDEIKSFENYHHIETAIHQAISDTIDERENGETVGSLSVIEKLQNHDDEAVRNAGDLLYQKTQNNILKL
VFGNGENPALNIEEKITILQVKGLDIPKADDDPSTYSTSEQNGITLMLLIGKFLQKFGSRRQIQTTIFID
EGWAFSASRQGKKVAKGIKRMGRSENNSLVFITQSVKDKADEDGGNFGCHFAFDEKDEREDILKSLDLEY
SKESPENMEMLKDLKKGQCIFSDFYGRVGKMAVHCPFEEMTEAFRTQEDSASSKAEEKFAI
 
Nucleotide Sequence: 2496 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1756582-1754087 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGGATTTAAAAGCGCCCTACGCAGGGATAAAAAACAATTTATTATTAACTAAAAATGGCGAAGTTTGGG
CGTATTATCGTATACGTTCGGAATCCATTTCAACAGCGAATTATGATGCTAAAGAAGCGTCTAAAAAACG
TATGAAATACTTTCTTGAGTCGATTAAAGGTTATCAAGATTTTCATTTTGAAATGTATGAACATGATTTA
GATCTTAGAAATAAGTTCAAAGAAATTAGTAAAGATTTTGATGATACAACATTTGATGTCGCAAATTATT
ATGCGCAAGAAACGATCGATGTGTTAGAACAAGAATTACAAATGATAACACATAATTCATTTGTAATGGG
TGTTAAGCTTAGAGAATTAAGTGATGACGCGGTTTCAATTAAAGAAATGGTAAAAAGTACGTTGTCAGAT
ACAGCGGAACGCATGATTTCAAATTTAGGCTTTAATGTCTCGTTAGATGATAAAGTATTAAGTCGTTATG
AAAGTTTTGAACGTGAACTTGCGGATAATTTTCTGAGTATTGAAGGCGAACGTTTAACAGAAAATGAACT
CGCTTATATAGTGAGAAAGCCATTTATTTCAAATGCAACACACGATGTACAAGAAGAGTCAGCACGACGT
GCTGTCACTGATGTTTGTAATGTGGTGATAGACCCTACACAAATGAGAGTATTGAAAGTGACGAATGAAA
ATGAAACGTTTTATACAACAACGGTTGTTGTTGATGATTTTCCATTGGATATGGAATATACACATATCTT
TGAAAAAGCACAAAATATGCCGTTTCCAGTTGAATGTCATATTAAAGCAAAGATTGTTGAAAATGATAAA
GTGAAAAAGAAATTCGATCGCGCAAAAATTAACCACAAAGCACAATCTAGAGAAAAACAAGCGACTGGTG
ATAATGCTTCAGAAGAAATACAAGATAATTTATTTGTGTTAGAACAAATGGAAAAAGAAGTGACAGGCTC
AGGCGTGTTTATGGAATGGTCTTGTTTATTTGTGATTAAGAGTGATGACCTAAGAGATTGTAAGCGTAAA
GCTAAGCGTTTAGTGAAACGCTTGAAAGAGACGGAGATTTACGCCGTAAATCCTCTAGCTGACCAATTAC
AATTATATTATCAAGTCTTACATGGCAATGACTTATTTATTAATAAGTATTGGGTACAACGCACGACGGC
GACAGGTATTGCCGAAAACCTTTTCGGTGTATCACAAAGCTTAGGTACGAAAACAGGTTTTTATATCGGA
CGCATTGATAAATTTATACGTTCCGTTTCACGTGAAGAAGCCGTCGCAAGTTCAAGAGATATTATTCTTT
TTAGTTTATTACTTGCGGCAAAAGGTATTAAAGGGGCTGTGAGTGATAGTCCACACGTATTAATTACAGG
TCAAACGGGTAAAGGTAAGTCATTTTTAGCTAAGCTCCTTTGGCTATATACCTCATTCTTTAAAGGGCAA
ATGATTTATTGGGACCCGAAAAGTGAATTTGCGGACTGGTTTAATAAGATTACAGAAAGTGAAGAAATGA
GACGAAAATATCCCTTGTTTGTTAGTCATTTAGAGACATTTAAATATGTGACATTAGATTATAATAAATC
AAATAACTTTGGTTGTTTAGACCCGATCGTCTTTTTAAATGGGATTGAAGCCAATGAGATGTTGAAATCT
GTATTTGATGAAATTAAATCATTTGAAAATTATCATCATATTGAAACAGCGATACATCAAGCGATTTCAG
ATACGATAGATGAACGCGAAAACGGTGAAACCGTTGGTTCACTTAGCGTGATAGAAAAGCTACAAAACCA
TGATGATGAAGCTGTACGTAATGCGGGTGATTTGTTGTATCAGAAGACACAAAATAATATTTTAAAGTTG
GTATTTGGTAATGGTGAAAATCCAGCATTAAATATTGAAGAAAAGATAACGATATTACAGGTTAAAGGCT
TGGATATTCCAAAAGCAGATGATGACCCTTCCACATATAGTACAAGTGAACAAAACGGTATTACATTAAT
GTTGTTAATCGGTAAATTCTTACAAAAATTTGGCTCACGTAGACAAATTCAAACGACCATATTTATTGAT
GAAGGTTGGGCGTTTAGTGCGTCACGTCAAGGTAAGAAAGTAGCGAAAGGCATTAAACGTATGGGTCGAT
CTGAAAATAATTCGCTTGTCTTTATTACACAATCTGTTAAAGATAAAGCCGACGAAGACGGCGGTAACTT
TGGCTGTCATTTTGCGTTTGATGAAAAAGATGAACGAGAAGATATTTTAAAATCTCTTGACTTAGAATAT
TCAAAAGAAAGTCCTGAAAACATGGAAATGTTGAAAGACTTGAAGAAAGGTCAATGTATTTTCAGTGATT
TCTACGGACGTGTAGGCAAAATGGCTGTACATTGTCCATTTGAAGAAATGACAGAAGCATTTAGAACACA
AGAAGACTCAGCAAGTTCAAAAGCAGAAGAAAAATTTGCGATATAG
 Primer design