SecReT4
Protein ID: 269203330
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1702
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1756617..1757006 [-]
Producttransposon-related protein
Component typeYddD
UniProt IDD0K5T3
KEGG IDsad:SAAV_1702
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 4.8e-18, Aligned region: 7..113
Protein Sequence: 129 a.a.     [Download]
>gi|269203330|ref|YP_003282599.1| conserved hypothetical protein, transposon-related protein [Staphylococcus aureus subsp. aureus ED98]
MDKKAYNLKRTFEQPIVMYEFTNNARFSKGIRIDWVATFVVLELILAILYFKLGFHYIVSVISGLKIIYF
TALPYYMTKYLVKLKQDGKKLVFFLWDFITYVFNIQMRNVHYAYDEEVKYHNKKLIKLK
 
Nucleotide Sequence: 390 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1757006-1756617 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGGATAAAAAAGCCTATAACTTAAAACGAACATTTGAACAGCCTATCGTCATGTATGAATTTACTAACA
ATGCACGTTTTTCAAAAGGTATTCGTATTGATTGGGTCGCTACATTTGTAGTTTTAGAGTTAATACTTGC
GATACTGTATTTTAAATTAGGTTTTCATTATATTGTATCAGTAATTAGTGGTTTGAAAATTATTTATTTT
ACAGCGCTCCCCTATTATATGACAAAGTATTTAGTGAAGTTAAAACAAGATGGTAAAAAATTAGTTTTCT
TCCTTTGGGATTTTATAACCTATGTATTTAATATTCAAATGCGTAATGTGCACTATGCATATGACGAAGA
AGTGAAATATCATAATAAGAAATTAATCAAATTGAAATAG
 Primer design