SecReT4
Protein ID: 269203331
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1703
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1757012..1757272 [-]
Producttransposon-related protein
Component typeYddC
UniProt IDD0K5T4
KEGG IDsad:SAAV_1703
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 86 a.a.     [Download]
>gi|269203331|ref|YP_003282600.1| conserved hypothetical protein, transposon-related protein [Staphylococcus aureus subsp. aureus ED98]
MDNLFNFMMVLGNTPTINPLKDLVSREVGSAIGIIVLIVGCMKWAGGKYGHMVLLFVVGGFMFLVSKGPE
TVFNALSGLWKLIFGG
 
Nucleotide Sequence: 261 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1757272-1757012 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGGATAATCTTTTTAATTTTATGATGGTGTTAGGTAATACACCTACGATTAACCCACTAAAAGATTTAG
TTAGTAGAGAAGTTGGGTCAGCAATCGGGATTATTGTATTGATTGTCGGTTGTATGAAATGGGCTGGTGG
TAAATATGGACATATGGTTTTGTTATTTGTTGTTGGTGGCTTCATGTTCTTGGTTTCTAAAGGTCCAGAA
ACTGTGTTTAATGCATTGTCTGGGCTTTGGAAACTAATATTTGGAGGCTGA
 Primer design