SecReT4
Protein ID: 269203332
T4SS name [ID]Ydd [626]
Gene symbol-
Locus tagSAAV_1704
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1757277..1758353 [-]
Producttransposon-related protein
Component typeYddB
UniProt IDD0K5T5
KEGG IDsad:SAAV_1704
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.3e-41, Aligned region: 103..351
Protein Sequence: 358 a.a.     [Download]
>gi|269203332|ref|YP_003282601.1| conserved hypothetical protein, transposon-related protein [Staphylococcus aureus subsp. aureus ED98]
MRKIFLNIIHKLILSRFSKKGKQFDVPEAERKELPKYRNHRKKIVVIFYTVLIILTVLLLAAFVRASKAN
NESKQAVNKTEEIQKKYEDNAETVQYNPNLKLYADKYIDTYMNIPKGGKEKEERQKALENFYPSDYKSPT
ENTENVERKLNEKEFFNIKRKDKQTIIQYIVNYDLKITEKKEVKVKKKKDKKDKDKKEEYETKTEEKTRT
ESKKALLNIPVKSENNKYVVVEYPHFSIVPNNQLKQAKLVKDNLENEKREDNPKLKAFVEDFFNKYTKSK
ADDMAYLMDNPEGLEDTREVSKISDLRIYPKKNDYVIKAEVLMKDKGSPLENLEHYTLEVTKKDGKYYVK
KLTTTFGG
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|269201690|ref|NC_013450.1|:c1758353-1757277 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGCGAAAAATCTTTTTAAATATCATTCATAAATTGATATTATCTAGATTTTCGAAAAAAGGCAAACAGT
TTGATGTGCCAGAAGCAGAGCGTAAAGAATTACCGAAGTATCGCAACCACAGAAAAAAGATTGTGGTTAT
TTTTTATACCGTTTTAATTATTTTGACTGTTCTATTATTGGCTGCTTTTGTTAGAGCGTCTAAAGCGAAT
AACGAAAGTAAACAAGCTGTTAATAAAACAGAAGAAATTCAAAAGAAATATGAAGATAACGCTGAAACGG
TTCAGTATAACCCAAACCTTAAGTTATATGCAGACAAATATATTGATACGTATATGAACATCCCTAAAGG
CGGTAAAGAAAAAGAAGAACGACAAAAAGCATTGGAAAACTTCTACCCTTCTGATTATAAAAGTCCTACA
GAAAATACTGAAAATGTTGAACGTAAGTTAAATGAAAAAGAGTTTTTCAATATTAAACGTAAAGATAAAC
AGACAATCATTCAGTATATTGTGAATTACGATCTGAAAATTACGGAGAAAAAGGAAGTTAAAGTCAAGAA
AAAAAAAGATAAGAAGGATAAAGATAAAAAAGAGGAATATGAGACAAAGACAGAAGAAAAAACACGTACA
GAAAGTAAGAAAGCATTGTTAAATATTCCTGTTAAAAGTGAAAATAATAAGTATGTCGTTGTGGAATACC
CCCACTTTTCAATTGTCCCAAATAATCAATTGAAACAAGCGAAGCTTGTCAAAGATAATTTGGAAAATGA
AAAGCGTGAAGATAACCCGAAATTAAAAGCGTTTGTTGAAGACTTTTTTAATAAATACACAAAAAGTAAA
GCCGATGATATGGCTTATTTAATGGATAATCCCGAAGGGTTAGAAGATACAAGAGAAGTATCTAAAATTA
GTGACTTGCGTATTTATCCTAAGAAGAATGATTATGTCATTAAGGCAGAGGTTTTAATGAAAGATAAAGG
GTCGCCACTTGAGAATTTAGAACATTATACGTTGGAAGTGACAAAGAAAGACGGAAAATATTACGTTAAG
AAATTAACAACAACATTTGGAGGTTAA
 Primer design