SecReT4
Protein ID: 269203523
T4SS name [ID]Ydd [627]
Gene symbol-
Locus tagSAAV_1936
StrainStaphylococcus aureus subsp. aureus ED98
Repliconchromosome [GenBank: NC_013450] [Browse all T4SS(s) in this replicon]
Location [Strand]1971414..1972772 [+]
Productftsk/spoiiie family protein
Component typeYdcQ
UniProt IDD0K6C6
KEGG IDsad:SAAV_1936
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 1.1e-23, Aligned region: 209..369
Protein Sequence: 452 a.a.     [Download]
>gi|269203523|ref|YP_003282792.1| ftsk/spoiiie family protein [Staphylococcus aureus subsp. aureus ED98]
MAMNEIALFKGVRIQPYQKYIDFMFASVLAFIFLVYRIYILFIDYKSVNKKLDILTLFAYFKPHLLYLLI
GTAIIFVICKLIAQFLIRFKTKDLAEMIETQGFHNHTVIKKTTEYIPIDYKQTEYDYYPTMFYKRGKKSF
VIHIKKDGSRFQDNYLELETIIEPMFNSELVEKKHIGRYLRYEFMPLKYKKRIVMNGEQESNTIFYDTKI
AITHQITWDFVKAPHGLVTGITGGGKTYFLFYVIRELFRRHSEVRLLDPKVSDLSFMKRVIGDDKVADTK
GQILKQLREANNEMEERFRLMNDSSDYKIGNDFRNFDMRPYFIIFDEVTAFTSTLDKKELQEMNDYLINI
IMKGRQAGVFMFLTAQRPDADVIKGNVRDQLGLRVSLGNLSNDGYRMTFGQTDKEFQTIHDSDIGRGYIS
ILGQYNEPILFDAPLMEQYDFVEDVKQILNKE
 
Nucleotide Sequence: 1359 bp     [Download]
>gi|269201690|ref|NC_013450.1|:1971414-1972772 Staphylococcus aureus subsp. aureus ED98, complete genome
ATGGCAATGAATGAAATTGCTTTATTTAAAGGCGTACGTATACAGCCTTATCAGAAGTATATTGATTTTA
TGTTTGCAAGTGTATTAGCATTTATTTTTTTGGTATATCGTATATATATTTTGTTTATTGATTATAAATC
AGTTAATAAAAAATTGGATATATTGACGTTGTTTGCATATTTTAAACCGCATTTATTGTATTTATTAATT
GGTACAGCAATTATATTTGTGATATGTAAGCTTATTGCTCAGTTTTTAATACGTTTTAAAACAAAAGATT
TGGCTGAAATGATTGAAACACAAGGTTTTCATAATCATACAGTAATCAAGAAAACAACTGAGTATATCCC
TATTGATTATAAACAAACTGAATATGATTATTATCCAACAATGTTTTATAAGCGTGGTAAAAAATCTTTT
GTTATTCATATTAAGAAAGACGGTTCGAGGTTTCAAGATAATTATTTAGAGTTAGAGACGATTATTGAAC
CAATGTTTAATTCTGAATTAGTAGAAAAAAAGCATATTGGTCGTTATTTGAGATATGAATTTATGCCACT
TAAATATAAAAAGCGTATTGTTATGAATGGCGAACAAGAATCAAATACAATTTTTTATGATACAAAAATT
GCTATTACGCATCAAATTACTTGGGATTTTGTGAAAGCACCTCATGGATTGGTTACAGGTATAACCGGAG
GTGGTAAAACATATTTTTTATTTTATGTGATTCGTGAGTTATTCCGTAGACATTCAGAAGTACGTTTATT
AGACCCAAAAGTTTCAGATTTGAGCTTTATGAAGCGCGTTATTGGTGATGATAAAGTTGCAGATACTAAA
GGTCAAATATTAAAACAATTGAGAGAAGCTAATAATGAAATGGAAGAGCGTTTTAGATTAATGAATGATA
GTTCGGATTATAAAATCGGGAATGATTTCCGTAATTTTGATATGCGCCCCTATTTCATTATTTTTGATGA
GGTAACGGCTTTTACTTCAACTTTAGATAAAAAAGAATTACAAGAAATGAATGATTATTTAATTAATATT
ATTATGAAAGGTCGTCAAGCTGGTGTATTTATGTTTTTAACAGCACAAAGACCAGATGCAGATGTGATTA
AAGGTAATGTGCGTGACCAATTAGGGTTACGTGTGTCTTTAGGTAATTTGTCAAATGATGGTTATCGTAT
GACCTTTGGTCAAACTGATAAAGAATTTCAAACGATTCATGATAGTGATATCGGCCGAGGTTATATTTCT
ATACTTGGACAATATAATGAACCAATTTTATTTGATGCACCTTTAATGGAACAATATGATTTTGTAGAAG
ATGTGAAACAAATATTAAATAAGGAGTGA
 Primer design