SecReT4
Protein ID: 269958321
T4SS name [ID]VirB [415]
Gene symbolvirB8
Locus tagACIS_00090
StrainAnaplasma centrale str. Israel
Repliconchromosome [GenBank: NC_013532] [Browse all T4SS(s) in this replicon]
Location [Strand]82441..83130 [+]
Producttype IV secretion system protein VirB8
Component typeVirB8
UniProt IDD1ATB6
KEGG IDacn:ACIS_00090
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 8.8e-54, Aligned region: 20..227
Protein Sequence: 229 a.a.     [Download]
>gi|269958321|ref|YP_003328108.1| type IV secretion system protein VirB8 [Anaplasma centrale str. Israel]
MGIFSFGKKDGGAAVSASTDDWYHDRYSSVVVQRNVLLLLVVLSVFCIAVSTFVIFRIGKTRTIEPFVVE
IEKKSGITTLVNPITVKQYSADEVLGNYFIIEYVRARELYDPNNFQYNYYTKVRLLSSQETYGEFRNWIR
PSNPSSPMTLYSDAVSGNLKVRSLQHLSTGNVQIRFSLEFNNHNGSITKRDRIATLSFRYSSLEMNDQDR
QVNPLGFQITYYRADDEFL
 
Nucleotide Sequence: 690 bp     [Download]
>gi|269958255|ref|NC_013532.1|:82441-83130 Anaplasma centrale str. Israel chromosome, complete genome
ATGGGCATATTTAGTTTCGGTAAGAAGGATGGGGGTGCCGCCGTTTCCGCGAGCACCGATGACTGGTATC
ATGACAGATACAGCTCGGTTGTGGTCCAACGGAACGTCCTGCTTCTCCTGGTGGTGTTGTCCGTATTCTG
CATTGCAGTAAGCACCTTTGTCATTTTCAGGATAGGGAAGACGAGGACAATCGAGCCGTTTGTGGTTGAG
ATAGAAAAGAAGTCGGGTATTACCACGTTGGTCAACCCGATCACGGTAAAACAGTACTCCGCTGACGAGG
TCTTGGGCAACTATTTCATCATCGAGTATGTGCGGGCGAGGGAGCTGTACGACCCGAATAATTTTCAGTA
CAACTACTACACAAAGGTGCGGCTGCTTTCCTCCCAGGAAACTTATGGTGAGTTCCGCAACTGGATACGT
CCTAGCAACCCCTCCAGCCCTATGACGCTGTATTCAGACGCGGTGTCTGGTAACCTGAAGGTGCGGTCTT
TGCAGCATCTGAGCACAGGAAACGTGCAGATTAGGTTTTCCCTGGAGTTTAACAACCACAATGGGTCTAT
CACCAAGAGGGATAGGATTGCCACTCTCTCCTTCAGGTACTCTTCGCTTGAGATGAACGACCAGGATAGG
CAAGTAAACCCTCTGGGATTTCAAATTACTTACTATAGGGCAGACGATGAATTTCTATAA
 Primer design