SecReT4
Protein ID: 269958324
T4SS name [ID]VirB [415]
Gene symbolvirB11
Locus tagACIS_00093
StrainAnaplasma centrale str. Israel
Repliconchromosome [GenBank: NC_013532] [Browse all T4SS(s) in this replicon]
Location [Strand]85371..86369 [+]
Producttype IV secretion system protein VirB11
Component typeVirB11
UniProt IDD1ATB9
KEGG IDacn:ACIS_00093
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 5.9e-87, Aligned region: 12..312
Protein Sequence: 332 a.a.     [Download]
>gi|269958324|ref|YP_003328111.1| type IV secretion system protein VirB11 [Anaplasma centrale str. Israel]
MTAGYAALETYLEPLQSIFAEDGVNEISINRECEVWVENRGDIRCERIESLTLSHLKALGRLVAQATEQK
LSEETPLLSASLPNGFRVQVVFPPACEGDKVVFSIRKPSTVQLSLEDYEKMGAFAHVAQQGRKAMDVNKK
LSEFLSSGDIKSFIELAVLSKKNIIVSGGTSTGKTTFTNAALRVIPKDERIITVEDSREIALDHPNRVHL
LASKGGQGRAKVSTQDLIEACLRLRPDRIIVGELRGAEAFSFLRAINTGHPGSISTLHADTPRMAVEQLK
LMVMQASLGLPPEQIVDYITNIVDVIIQLKRESGGVRHVSEIMFTKCSQGND
 
Nucleotide Sequence: 999 bp     [Download]
>gi|269958255|ref|NC_013532.1|:85371-86369 Anaplasma centrale str. Israel chromosome, complete genome
ATGACAGCGGGATATGCAGCGTTAGAGACATACTTGGAGCCCCTGCAGAGCATATTCGCGGAGGATGGGG
TTAATGAAATCTCGATCAACAGGGAATGCGAGGTATGGGTAGAGAACAGGGGCGATATACGGTGTGAGAG
GATTGAGAGTCTGACTCTGTCTCATCTCAAGGCACTCGGCAGGTTGGTGGCACAAGCAACTGAGCAAAAG
TTGAGTGAGGAAACGCCTTTGTTGTCGGCTTCTTTGCCCAACGGTTTCCGTGTGCAGGTGGTGTTTCCCC
CCGCTTGCGAGGGTGATAAAGTCGTATTCTCCATAAGAAAGCCATCGACGGTGCAGCTGTCACTCGAGGA
TTATGAGAAAATGGGTGCGTTCGCCCATGTAGCCCAGCAGGGCCGCAAGGCTATGGACGTGAACAAGAAG
CTTAGTGAGTTTCTGAGTAGTGGGGATATCAAGTCTTTCATAGAGCTCGCGGTGCTGAGCAAAAAAAACA
TAATAGTCAGCGGGGGTACGTCCACTGGGAAAACTACGTTCACGAACGCGGCGCTGCGGGTTATCCCAAA
GGATGAAAGGATAATAACTGTGGAAGACTCTAGAGAAATAGCGCTAGACCACCCCAATAGGGTGCATCTA
TTAGCATCTAAGGGCGGCCAGGGGCGCGCTAAGGTCTCTACTCAAGATCTTATAGAGGCCTGCTTGCGTC
TTCGGCCAGATAGGATAATCGTGGGGGAGCTCAGGGGGGCTGAGGCGTTCAGCTTTCTCAGAGCCATAAA
TACAGGGCACCCGGGCTCTATCTCCACCTTGCATGCAGACACGCCTAGAATGGCTGTGGAGCAGCTGAAA
CTTATGGTAATGCAAGCAAGCCTGGGGTTGCCACCGGAACAAATAGTAGACTACATCACCAACATAGTAG
ACGTAATTATACAGCTAAAAAGGGAGTCTGGAGGAGTGCGGCACGTCTCGGAGATTATGTTCACCAAATG
TTCACAAGGCAATGATTAA
 Primer design