SecReT4
Protein ID: 269958325
T4SS name [ID]VirB [415]
Gene symbolvirD4
Locus tagACIS_00094
StrainAnaplasma centrale str. Israel
Repliconchromosome [GenBank: NC_013532] [Browse all T4SS(s) in this replicon]
Location [Strand]86417..88843 [+]
Producttype IV secretion system protein VirD4
Component typeVirD4
UniProt IDD1ATC0
KEGG IDacn:ACIS_00094
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.7e-150, Aligned region: 124..568
TraG-D_C [PF12696], Evalue: 1.7e-26, Aligned region: 407..529
TrwB_AAD_bind [PF10412], Evalue: 1.2e-25, Aligned region: 240..543
Protein Sequence: 808 a.a.     [Download]
>gi|269958325|ref|YP_003328112.1| type IV secretion system protein VirD4 [Anaplasma centrale str. Israel]
MHSSSNHIRNILVFFFGMFFLLEFCFYISGALFVLSMWGLEYLDFNALNPSISDFPMRLWPTIFNYIHGW
WADPKLYGVPNSLKLWLSFAAPLCIVGTVFWNLRHILLEWRPFRKKEALHGDSRWASERDIRKIGLRSRK
GLLLGKDQRGYLVADGYQHALLFAPTGSGKGVGFVIPNLLFWEDSLVVHDIKLENYDITSGWRKKIGQEV
YVWNPAQPDGISHCYNPLDWISKKPGQMVDDVQKIANLIMPEQDFWYNEARSLFVGVVLYLLAVPEKVKS
FGEVVRTMRSDDVVYNLAVVLDTIGKKIHPVAYMNIAAFLQKADKERSGVVSTMNSSLELWANPLIDTAT
ASSDFNIQEFKKKKITVYVGLTPDNLTRLRPLMQVFYQQATEFLCRALPSDDEPYGVLFMMDEFPTLGKM
EQFQTGIAYFRGYRVRLFLIIQDTEQLKGIYEEAGMNSFLSNSTYRITFAANNIETANLISQLIGNKTVS
QESLNRPKFLDLNPASRSLHISDTQRALLLPQEVIMLPKDEQILLIESTYPIKSKKIKYYEDKFFTKKLL
KSTFVPTQEPYDPDAARGGVDTVAEDVPTSEEGEQQAAIAHEESAQEAQQPQEQHGDEAGYDEFGDYPQD
YDYSSEDDEYMEGLDDIEGEDVPLNGEGLDDIGDEDGYPEDHVSDEGHPEEDELLAYEEEHTDGELQQGD
EDGYGGGDEEPYYEENDGGEPYEADEIRGSEGEATDVYPAEDELLAYEEEPTDGELQDAEDEYSSGDEEP
YYEESGGDEPYGEDETYDDEDTQPPRRDGKQRDDDNPQ
 
Nucleotide Sequence: 2427 bp     [Download]
>gi|269958255|ref|NC_013532.1|:86417-88843 Anaplasma centrale str. Israel chromosome, complete genome
ATGCACAGTAGCTCTAACCACATACGTAACATTTTGGTGTTCTTCTTCGGGATGTTTTTCCTCCTGGAGT
TCTGTTTTTACATCTCGGGGGCACTTTTTGTTCTTTCAATGTGGGGTCTTGAGTACTTAGACTTCAACGC
TCTGAACCCCAGCATATCAGACTTCCCCATGAGGTTATGGCCAACAATTTTCAATTACATCCACGGGTGG
TGGGCTGATCCCAAGTTATATGGGGTGCCTAATTCGCTGAAGTTGTGGCTATCCTTCGCGGCACCGTTGT
GTATAGTGGGCACTGTCTTTTGGAATCTGCGGCACATTCTCCTGGAGTGGCGACCTTTCCGAAAGAAAGA
GGCCTTGCATGGTGATTCCAGATGGGCGTCGGAGCGCGATATACGTAAAATTGGCCTCAGAAGCAGGAAG
GGTCTGCTTCTTGGAAAAGACCAAAGGGGGTATTTAGTAGCAGATGGCTACCAGCACGCATTGCTTTTCG
CGCCTACAGGGTCAGGTAAAGGTGTGGGGTTTGTAATACCCAATCTTCTGTTCTGGGAAGACTCGCTCGT
GGTGCATGACATCAAGCTGGAGAACTACGACATCACAAGTGGGTGGCGCAAGAAGATCGGGCAGGAAGTT
TATGTGTGGAACCCTGCACAACCTGACGGTATCAGCCACTGTTACAATCCTTTGGACTGGATAAGCAAAA
AACCCGGCCAGATGGTGGATGATGTGCAAAAAATCGCGAACCTCATTATGCCTGAGCAAGACTTTTGGTA
TAACGAGGCTCGCAGCCTTTTCGTCGGTGTCGTATTGTATTTACTAGCAGTTCCGGAAAAGGTCAAATCA
TTTGGTGAAGTTGTGCGCACAATGCGCAGTGATGATGTAGTTTATAACCTGGCTGTGGTTTTGGATACCA
TAGGGAAAAAAATCCATCCAGTAGCATATATGAACATTGCGGCTTTCCTCCAGAAGGCCGATAAGGAACG
GTCAGGGGTGGTCTCAACAATGAACTCATCCCTGGAACTGTGGGCCAACCCCTTGATTGACACCGCAACC
GCGTCTAGTGACTTCAACATTCAGGAGTTCAAGAAAAAGAAGATCACAGTATACGTGGGCCTCACCCCAG
ATAACCTGACCAGGCTCAGGCCTCTAATGCAGGTATTCTATCAGCAGGCGACCGAGTTTTTGTGTAGGGC
GTTGCCATCGGACGATGAGCCCTATGGGGTTCTGTTCATGATGGATGAGTTCCCCACGCTAGGAAAAATG
GAGCAATTCCAAACCGGTATTGCGTACTTCCGCGGTTATAGAGTTAGGCTGTTCTTGATAATACAAGATA
CCGAACAGCTGAAGGGTATATACGAAGAAGCGGGTATGAACTCCTTCCTCTCAAACTCTACTTATAGGAT
CACGTTTGCGGCAAATAATATTGAAACTGCAAACTTGATTTCTCAGCTCATAGGTAACAAAACCGTGAGC
CAGGAATCGCTGAATAGGCCGAAATTTTTGGATTTGAATCCTGCATCGCGCTCCTTGCACATTTCAGATA
CTCAGCGGGCGCTGTTGCTTCCACAGGAAGTGATCATGCTACCGAAAGATGAGCAGATTTTATTGATCGA
ATCTACGTATCCGATCAAATCGAAAAAGATTAAGTACTATGAGGATAAGTTTTTCACTAAGAAGCTACTC
AAGAGCACTTTTGTCCCGACGCAGGAACCTTATGATCCAGATGCGGCACGGGGAGGAGTGGACACAGTCG
CTGAGGATGTGCCTACATCTGAAGAAGGAGAGCAGCAGGCTGCCATTGCTCATGAAGAAAGCGCTCAGGA
GGCGCAGCAACCCCAAGAACAACATGGTGATGAGGCTGGGTACGACGAATTCGGAGATTATCCACAAGAC
TATGACTACAGCTCAGAAGATGATGAGTACATGGAAGGTCTGGATGACATAGAAGGAGAGGATGTACCAC
TAAACGGAGAGGGCCTGGACGATATAGGTGACGAAGACGGCTACCCGGAAGATCACGTTAGCGACGAAGG
ACATCCGGAGGAGGATGAACTCCTAGCATATGAAGAGGAGCACACTGATGGTGAGCTACAACAAGGTGAT
GAAGATGGGTATGGTGGCGGAGATGAAGAGCCGTATTACGAGGAAAATGACGGTGGTGAGCCGTATGAGG
CAGATGAAATACGCGGTTCAGAGGGCGAGGCCACTGACGTGTATCCAGCGGAGGATGAACTCCTAGCATA
TGAAGAGGAGCCCACTGATGGTGAGCTGCAAGATGCCGAAGACGAGTATAGCAGCGGAGATGAAGAGCCG
TACTATGAAGAAAGTGGCGGCGATGAGCCGTACGGGGAAGACGAAACATACGATGACGAGGATACGCAAC
CCCCCCGTCGCGACGGCAAGCAGCGCGATGATGACAACCCGCAATGA
 Primer design