SecReT4
Protein ID: 269959007
T4SS name [ID]VirB [415]
Gene symbol-
Locus tagACIS_00993
StrainAnaplasma centrale str. Israel
Repliconchromosome [GenBank: NC_013532] [Browse all T4SS(s) in this replicon]
Location [Strand]991739..991906 [+]
ProductVirB7
Component typeVirB7
UniProt IDD1ASM9
KEGG IDacn:ACIS_00993
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 55 a.a.     [Download]
>gi|269959007|ref|YP_003328796.1| VirB7 [Anaplasma centrale str. Israel]
MRFSRVVLLLLVAAFGLQGCILFSKEERKIKSPCVRAGNGQQTCERHPVNQWWLG
 
Nucleotide Sequence: 168 bp     [Download]
>gi|269958255|ref|NC_013532.1|:991739-991906 Anaplasma centrale str. Israel chromosome, complete genome
ATGAGATTTTCTAGGGTGGTGCTCTTGCTTCTTGTCGCTGCATTCGGGCTGCAGGGGTGCATACTGTTTT
CCAAGGAAGAGCGTAAGATTAAGAGCCCATGCGTCAGGGCTGGTAATGGCCAACAAACGTGTGAGCGTCA
TCCGGTGAATCAGTGGTGGCTTGGGTGA
 Primer design