SecReT4
Protein ID: 270208281
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgB
Locus tagpBEE99p09
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]8127..12044 [+]
ProductPrgB
Component typePrgB
UniProt IDD1LHE6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GbpC [PF08363], Evalue: 3.3e-66, Aligned region: 256..547
Gram_pos_anchor [PF00746], Evalue: 8.8e-10, Aligned region: 1263..1301
Protein Sequence: 1305 a.a.     [Download]
>gi|270208281|ref|YP_003329058.1| PrgB [Enterococcus faecalis]
MKQQTEVKKRFKTYKAKKRWVTAPILFIGVLGVVGLATDNVQAAELDTQPETTMVQPDNPDPQVGSTTPK
TEVSEEAPVQKDTTSQPTKVEEVAPEKNGAEQSSATPNDTTNAQQPTVGAEKSAQEQPVVSPETTNEPLG
QPTEVAPAENEANKSTSIPKEFETPDVDKAVDEAKKDPNITVVEKPAEDLGNVSSKDLAAKEKEVDQLQK
EQAKKIAQQAAELKAKNEKIAKENAEIAAKNKAEKERYEKEVAEYNKHKNENSYVNEAISKNLVFDQSVV
TKDTKISSIKGGKFIKATDFNKVNAGDSKDIFTKLRKDMGGKATGNFQNSFVKEANLGSNGGYAVLLEKN
KPVTVTYTGLNASYLGRKITKAEFVYELQSSPSQSGTLNAVFSNDPIITAFIGTNRVNGKDVKTRLTIKF
FDASGKEVLPDKDSPFAYALSSLNSSLTNKGGHAEFVSDFGANNAFKYINGSYVKKQADGKFYSPEDIDY
GTGPSGLKNSDWDAVGHKNAYFGSGVGLANGRISFSFGMTTKGKSNVPVSSAQWFAFSTNLNAQSVKPIF
NYGNPKEPEKATIEFNGYKANVVPVLVPNKEVTDGQKNINDLNVKRGDSLQYIVTGDTTELAKVDPKTVT
KQGIRDTFDAEKVTIDLSKVKVYQADASLNEKDLKAVAAAINSGKAKDVTASYDLNLDQNTVTAMMKTNA
DGSVVLAMGYKYLLVLPFVVKNVEGDFENTAVQLTNDGETVTNTVINHVPSSNPSKDVKADKNGTVGSVS
LHDKDIPLQTKIYYEVKSSERPANYGGITEEWGMNDVLDTTHDRFTGKWHAITNYDLKVGDKTLKAGTDI
SAYILLENKDNKDLTFTMNQALLAALNEGSNKVGKQAWSVYLEVERIKTGDVENTQTENYNKELVRSNTV
VTHTPDDPKPTKAVHNKKGEDINHGKVARGDVLSYEMTWDLKGYDKDFAFDTVDLATGVSFFDDYDETKV
TPIKDLLRVKDSKGVDITNQFTISWDDAKGTVTISAKDPQAFILAYGGQELRVTLPTKVKADVSGDVYNS
AEQNTFGQRIKTNTVVNHIPKVNPKKDVVIKVGDKQSQNGATIKLGEKFFYEFTSSDIPAEYAGVVEEWS
ISDKLDVKHDKFSGQWSVFANSNFVLADGTKVNKGDDISKLFTMTFDKGVVKITASQAFLDAMNLKENKN
VAHSWKAFIGVERIAAGDVYNTIEESFNNEKIKTNTVVTHTPEKPQTPPEKTVIVPPTPKTPQAPVEPLV
VEKASVVPELPKTGEKQNVLLTVVGSLAAMLGLAGLGFKRRKETK
 
Nucleotide Sequence: 3918 bp     [Download]
>gi|270208272|ref|NC_013533.1|:8127-12044 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGAAGCAACAAACAGAAGTAAAGAAACGTTTTAAAACATATAAAGCTAAGAAACGCTGGGTAACTGCTC
CTATTCTTTTTATAGGTGTGTTAGGAGTTGTAGGATTAGCTACTGATAATGTACAAGCAGCGGAATTAGA
TACGCAACCAGAAACAACCATGGTGCAACCTGATAATCCCGATCCACAGGTAGGTAGTACAACACCTAAG
ACAGAAGTATCTGAAGAAGCACCAGTACAAAAAGACACTACTTCTCAACCGACCAAAGTAGAAGAAGTAG
CGCCTGAAAAAAATGGAGCTGAACAGAGTTCAGCTACCCCAAATGATACCACAAACGCGCAACAACCAAC
AGTAGGAGCTGAAAAATCAGCACAAGAACAACCAGTAGTCAGCCCTGAAACAACCAATGAACCTCTAGGG
CAGCCAACAGAAGTTGCACCAGCTGAAAATGAAGCGAATAAATCAACGTCCATTCCTAAAGAATTTGAAA
CACCAGACGTTGATAAAGCAGTTGATGAAGCAAAAAAAGATCCAAACATTACCGTTGTTGAAAAACCAGC
AGAAGACTTAGGCAACGTTTCTTCTAAAGATTTAGCTGCAAAAGAAAAAGAAGTAGACCAACTACAAAAA
GAACAAGCGAAAAAGATTGCCCAACAAGCAGCTGAATTAAAAGCCAAAAATGAAAAAATTGCCAAAGAAA
ATGCAGAAATTGCGGCAAAAAACAAAGCGGAAAAAGAGCGCTACGAGAAAGAAGTCGCGGAATACAACAA
GCATAAGAACGAAAACAGCTATGTCAATGAAGCGATTAGTAAAAACCTAGTGTTCGATCAATCTGTCGTG
ACGAAAGACACTAAAATTTCGTCGATTAAAGGCGGAAAATTTATCAAAGCAACTGATTTTAATAAAGTAA
ATGCAGGGGATTCAAAAGATATCTTTACAAAATTACGGAAAGATATGGGTGGGAAAGCTACTGGCAACTT
CCAGAATTCCTTTGTAAAAGAGGCAAATCTTGGGTCTAATGGTGGGTATGCGGTTCTTTTAGAAAAAAAT
AAACCAGTGACAGTGACCTATACAGGACTAAACGCTAGTTATTTAGGACGTAAAATTACAAAAGCAGAAT
TTGTTTATGAACTACAATCCTCACCAAGCCAAAGTGGAACGTTAAATGCAGTATTTTCAAACGATCCGAT
TATCACAGCTTTTATTGGTACAAACAGAGTCAATGGTAAGGATGTTAAAACACGCTTAACGATTAAGTTC
TTTGATGCGTCAGGTAAAGAAGTACTACCAGATAAAGATAGTCCATTTGCGTATGCGCTGTCTTCTTTAA
ATTCAAGTTTAACGAATAAAGGTGGCCATGCGGAATTTGTTTCTGATTTTGGGGCCAACAATGCGTTCAA
ATACATTAATGGCTCATATGTGAAAAAACAAGCGGATGGAAAATTTTACTCACCGGAAGATATTGACTAT
GGCACAGGACCTTCTGGATTGAAAAATAGTGATTGGGACGCTGTAGGGCACAAGAATGCGTACTTTGGTT
CAGGTGTAGGTCTAGCTAATGGACGTATTTCCTTTTCTTTTGGTATGACAACAAAAGGAAAAAGTAATGT
GCCTGTATCTAGTGCGCAATGGTTTGCCTTTAGCACTAACTTAAATGCGCAATCAGTGAAGCCTATTTTC
AATTATGGGAATCCAAAAGAACCAGAAAAAGCAACGATTGAATTTAATGGATACAAAGCCAATGTCGTTC
CTGTTCTTGTTCCGAACAAAGAAGTCACTGATGGTCAGAAAAATATCAATGATTTAAATGTGAAACGTGG
CGACTCTTTACAATACATTGTGACAGGGGATACAACAGAACTTGCTAAAGTAGATCCAAAAACAGTAACA
AAACAAGGGATTCGAGATACATTTGATGCAGAAAAAGTGACGATTGATTTATCCAAAGTGAAAGTTTATC
AAGCAGACGCAAGTCTGAACGAAAAAGACTTAAAAGCTGTTGCTGCAGCGATTAATTCAGGAAAAGCGAA
AGACGTGACTGCTTCTTATGACCTCAATTTAGATCAAAACACCGTCACAGCAATGATGAAAACCAACGCG
GACGGCTCTGTTGTTTTAGCAATGGGGTATAAATATTTACTTGTCTTGCCGTTTGTAGTGAAAAATGTAG
AAGGCGATTTTGAAAATACAGCTGTTCAGCTGACAAATGATGGGGAAACGGTAACAAACACAGTTATCAA
TCATGTGCCAAGTAGCAACCCTTCCAAAGACGTAAAAGCAGATAAAAACGGTACAGTTGGCAGTGTCTCT
CTACATGATAAAGATATTCCGTTACAAACAAAAATTTATTATGAAGTGAAATCTTCCGAACGTCCAGCCA
ACTATGGCGGAATCACAGAAGAATGGGGCATGAATGATGTGTTGGACACGACCCATGATCGTTTCACAGG
GAAATGGCACGCTATTACGAATTATGACCTTAAAGTAGGGGACAAAACGCTAAAAGCAGGAACAGATATT
TCTGCCTACATTCTTTTAGAAAATAAAGACAATAAAGACTTGACGTTTACGATGAATCAAGCATTATTGG
CCGCCTTAAATGAAGGAAGCAATAAAGTAGGCAAACAAGCTTGGTCTGTGTATCTGGAAGTCGAACGGAT
TAAAACAGGTGACGTAGAAAACACGCAAACAGAAAACTACAACAAAGAGCTTGTTCGTTCTAATACGGTG
GTGACGCATACACCTGATGATCCAAAACCAACCAAAGCCGTTCATAACAAGAAAGGGGAAGACATTAATC
ATGGAAAAGTGGCTCGTGGTGATGTTCTTTCTTATGAAATGACTTGGGACTTAAAAGGGTACGATAAAGA
CTTTGCCTTTGATACAGTCGATCTTGCGACAGGCGTTTCTTTCTTCGATGATTACGATGAAACGAAAGTG
ACACCAATTAAAGACTTACTTCGTGTCAAAGATTCTAAAGGGGTAGACATTACGAACCAGTTCACGATCT
CATGGGACGATGCCAAAGGCACGGTGACGATTTCTGCCAAAGACCCACAAGCCTTTATTCTAGCGTATGG
TGGGCAAGAATTGCGTGTAACACTCCCTACAAAAGTCAAAGCTGATGTTTCTGGGGATGTTTATAATTCA
GCGGAACAAAATACATTTGGCCAACGAATTAAAACCAATACTGTTGTCAACCATATTCCAAAAGTGAATC
CTAAAAAGGATGTGGTCATTAAAGTTGGTGACAAACAAAGTCAAAATGGTGCCACAATCAAATTAGGGGA
GAAGTTCTTCTATGAATTTACAAGTAGTGACATTCCTGCAGAATACGCTGGAGTTGTGGAAGAATGGTCG
ATTAGCGATAAACTAGACGTCAAACATGACAAATTTAGTGGACAATGGTCTGTGTTTGCCAATTCTAATT
TTGTTTTAGCAGATGGAACCAAAGTGAATAAAGGGGACGACATTTCGAAACTATTCACGATGACCTTTGA
CAAAGGGGTAGTGAAAATCACGGCCAGTCAAGCCTTTTTGGATGCGATGAATCTAAAAGAAAACAAAAAC
GTTGCACACTCATGGAAAGCGTTCATTGGTGTAGAACGAATTGCGGCAGGAGACGTTTACAACACAATCG
AAGAATCTTTCAACAATGAGAAGATTAAAACGAATACGGTAGTGACACATACGCCAGAAAAACCACAAAC
ACCACCAGAAAAAACAGTGATTGTACCACCAACACCAAAAACACCGCAAGCACCAGTAGAGCCATTAGTG
GTAGAAAAGGCAAGTGTAGTGCCAGAATTGCCGAAAACAGGCGAAAAACAAAATGTCTTATTAACGGTAG
TTGGTAGTTTAGCCGCAATGCTTGGCTTAGCAGGCTTAGGCTTTAAACGTAGAAAAGAAACAAAATAA
 Primer design