SecReT4
Protein ID: 270208282
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgC
Locus tagpBEE99p10
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]12498..13355 [+]
ProductPrgC
Component typePrgC
UniProt IDD1LHE7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Gram_pos_anchor [PF00746], Evalue: 6.1e-09, Aligned region: 245..280
Protein Sequence: 285 a.a.     [Download]
>gi|270208282|ref|YP_003329059.1| PrgC [Enterococcus faecalis]
MKKIILSSLFSAVLVFGGGSITAFADDLGPTDPATPPITEPTDSSEPTNPTEPVDPAEPPVIPTDPTEPS
KPTDPTTPSEPEKPTEPTTPIDPGTPVEPTEPSEPTEPSQPTEPTTPSEPEKPVTPEQPKEPTQPVIPEK
PAEPETPKTPEQPTKPIDVVVTPSGEIDKTNQSAGTQPSIPIETSNLAEVTHVPSETTPITTEAGEEIVA
VDKGVPLTKTPEGLKPISSSYKVLPSGNVEVKASDGKMKVLPHTGEKFTLLFSVLGSFFVLISGFFFFKK
NKKKT
 
Nucleotide Sequence: 858 bp     [Download]
>gi|270208272|ref|NC_013533.1|:12498-13355 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGAAAAAAATTATTTTATCAAGCTTGTTTAGTGCAGTACTAGTATTCGGTGGCGGAAGTATAACAGCAT
TCGCTGACGATTTAGGACCAACAGATCCAGCAACTCCACCAATTACCGAACCAACTGATTCTAGTGAACC
TACGAATCCTACTGAGCCGGTGGATCCTGCAGAACCGCCAGTAATACCAACTGATCCAACAGAACCTAGC
AAGCCAACCGATCCTACAACACCGAGTGAGCCAGAAAAGCCAACAGAACCAACAACGCCAATTGATCCTG
GAACGCCGGTTGAACCGACTGAACCAAGCGAGCCAACAGAACCTAGTCAACCAACCGAGCCTACAACACC
AAGCGAACCAGAAAAACCTGTTACTCCAGAACAACCGAAAGAACCAACTCAACCAGTGATTCCAGAAAAA
CCAGCAGAACCAGAAACACCAAAAACTCCTGAACAGCCCACTAAACCAATAGACGTAGTCGTTACACCTA
GTGGAGAAATTGATAAAACGAATCAATCGGCAGGAACACAACCAAGTATTCCTATTGAAACAAGCAACTT
AGCGGAGGTAACACATGTACCAAGTGAAACTACTCCAATTACAACAGAAGCTGGGGAAGAAATTGTAGCA
GTAGATAAAGGTGTTCCGTTAACCAAAACACCAGAAGGATTAAAACCAATTAGCAGCTCGTATAAGGTTT
TACCTAGCGGAAACGTTGAGGTAAAAGCAAGTGATGGAAAAATGAAAGTATTGCCACATACAGGAGAGAA
ATTTACACTCCTTTTCTCTGTATTGGGAAGCTTCTTTGTATTAATTTCAGGATTCTTTTTCTTTAAAAAG
AATAAGAAAAAAACTTAA
 Primer design