SecReT4
Protein ID: 270208283
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgD
Locus tagpBEE99p11
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]13397..14296 [+]
ProductPrgD
Component typePrgD
UniProt IDD1LHE8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 299 a.a.     [Download]
>gi|270208283|ref|YP_003329060.1| PrgD [Enterococcus faecalis]
MLCLFILFTTKQSHVLLNELGFNRKIDLVQGIEQLTKINAALKKSTDRILITYEIYYNVTDEKAFVRETM
TLPVVEETVLQNMVQTVETNEEVRQEDLEAFLHLFKRNVSNKSKRIGRSTGSLKKKAEKQQKSTVFTTIY
RYSYFSVALLIFLAVGVFTGASFGSQSKPTSQNDSKLEERLTHLQEQVHEQPQVDVVARFFLSSLYSGEE
SDKATQKQVKKYVSEGVLKEIKGSKEQIRTLFLWESKKEGNTWLLTYVVTLKVAKEETEICQMKVAMEKK
NNNYQVTELPEEKEFTINE
 
Nucleotide Sequence: 900 bp     [Download]
>gi|270208272|ref|NC_013533.1|:13397-14296 Enterococcus faecalis plasmid pBEE99, complete sequence
GTGCTTTGCTTGTTTATTTTATTTACTACAAAGCAAAGTCATGTATTACTAAATGAATTAGGGTTTAATA
GAAAAATTGACCTGGTACAAGGTATTGAACAGTTAACAAAAATCAATGCGGCTTTAAAAAAATCGACGGA
TCGAATTCTAATTACGTATGAGATTTATTACAACGTGACAGACGAGAAAGCTTTTGTAAGAGAAACAATG
ACTTTGCCGGTAGTTGAGGAAACTGTCCTCCAAAACATGGTACAAACTGTAGAAACCAATGAAGAAGTAA
GACAAGAAGATTTAGAAGCGTTTCTTCACCTGTTCAAAAGAAATGTGAGTAATAAGTCGAAGAGAATAGG
CCGTTCAACAGGTTCTTTAAAAAAGAAAGCAGAAAAGCAACAAAAATCAACTGTGTTTACAACAATTTAT
CGCTATAGCTATTTCTCAGTGGCTTTACTTATATTTTTAGCAGTAGGTGTTTTTACAGGTGCGTCATTTG
GTTCTCAAAGTAAACCAACGAGCCAAAATGATTCTAAGTTAGAGGAACGATTAACACATTTACAAGAACA
AGTGCATGAACAACCACAAGTTGATGTTGTTGCTCGGTTTTTCTTATCCAGTCTGTACTCTGGTGAAGAG
AGTGACAAAGCCACGCAAAAGCAAGTTAAAAAGTATGTTTCTGAAGGAGTACTCAAAGAGATTAAGGGGT
CTAAAGAACAAATAAGAACGCTATTTCTTTGGGAATCAAAAAAAGAAGGCAACACATGGCTCCTTACGTA
CGTCGTTACCTTGAAAGTGGCTAAAGAAGAAACTGAAATTTGTCAAATGAAAGTAGCTATGGAAAAGAAA
AACAATAATTATCAAGTAACAGAACTTCCAGAAGAAAAAGAATTTACTATTAATGAATAA
 Primer design