SecReT4
Protein ID: 270208285
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgF
Locus tagpBEE99p13
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]14797..15024 [+]
ProductPrgF
Component typePrgF
UniProt IDQ5G3P9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 75 a.a.     [Download]
>gi|270208285|ref|YP_003329062.1| PrgF [Enterococcus faecalis]
MDIVTKIITLIGGIIGLVSAVSIMFGVKEIRSGMSNDDPRTLDKGIEKVVVGGAVILAIGGVVAYVITQV
GAIRF
 
Nucleotide Sequence: 228 bp     [Download]
>gi|270208272|ref|NC_013533.1|:14797-15024 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGGATATAGTCACAAAAATTATTACACTAATTGGAGGAATCATTGGACTTGTTTCAGCAGTTAGTATTA
TGTTTGGCGTGAAAGAAATTCGTTCAGGTATGTCGAATGATGATCCACGTACGCTTGATAAAGGAATAGA
AAAAGTAGTTGTTGGTGGGGCCGTTATTTTAGCAATTGGTGGGGTAGTCGCCTATGTCATTACACAGGTA
GGAGCTATTCGTTTTTAA
 Primer design