SecReT4
Protein ID: 270208287
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgH
Locus tagpBEE99p15
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]15349..16149 [+]
ProductPrgH
Component typePrgH
UniProt IDD1LHF2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 9.4e-05, Aligned region: 69..247
Protein Sequence: 266 a.a.     [Download]
>gi|270208287|ref|YP_003329064.1| PrgH [Enterococcus faecalis]
MNIPKGTTDQLFKSLAEYNPATNEAMSKIAKVLVPLGITILGILFMIELSNTQKKFQSEDGGLTIELLTN
IALKYVIAYVCIMGSGYIIDGIVWFTIQAAKWINSIVTATGTSEAIPQVGKVSWWAKPIVGLFEVFAYLA
LWLSSVITKILIFLRGVQLYMIKALAPLFVAFFVHDELRSIAMGYMKQIMAYALQGALLVLIMGIIPILT
ANDYLSFASFDGGIWANASAFVLNIMTYCALILKYVAVIILLVGSQGFAKRLVGAM
 
Nucleotide Sequence: 801 bp     [Download]
>gi|270208272|ref|NC_013533.1|:15349-16149 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGAACATTCCAAAAGGAACGACCGATCAGCTATTTAAAAGTCTAGCTGAATACAATCCAGCAACGAATG
AAGCCATGTCTAAAATAGCGAAAGTCCTAGTCCCTTTAGGAATCACTATTTTAGGCATTCTTTTTATGAT
TGAATTATCGAATACCCAAAAGAAATTTCAATCAGAAGACGGTGGTTTGACAATCGAGTTATTAACTAAC
ATTGCATTGAAATATGTGATCGCGTATGTCTGTATTATGGGCTCTGGCTACATTATTGATGGCATTGTCT
GGTTTACAATTCAAGCAGCCAAATGGATTAATTCCATTGTAACAGCAACAGGAACCAGTGAAGCGATCCC
ACAAGTGGGGAAAGTCTCCTGGTGGGCAAAACCGATTGTAGGTCTATTTGAGGTATTTGCTTACCTAGCA
CTATGGTTATCGAGTGTGATAACGAAAATCCTTATTTTCTTACGAGGGGTACAATTGTATATGATTAAAG
CCCTTGCGCCATTGTTTGTGGCGTTTTTTGTTCATGATGAATTACGTTCGATTGCCATGGGCTACATGAA
ACAAATTATGGCGTATGCTTTACAAGGTGCTTTACTGGTTCTAATAATGGGGATTATTCCAATTTTAACG
GCGAATGATTACCTTTCGTTTGCTTCATTTGATGGAGGTATATGGGCGAATGCTAGTGCATTTGTACTTA
ATATCATGACGTATTGTGCGTTAATTTTAAAATATGTGGCAGTGATTATTCTTCTGGTTGGTTCACAAGG
ATTTGCCAAACGATTAGTAGGAGCGATGTAA
 Primer design