SecReT4
Protein ID: 270208288
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgI
Locus tagpBEE99p16
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]16151..16504 [+]
ProductPrgI
Component typePrgI
UniProt IDD1LHF3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam PrgI [PF12666], Evalue: 4.1e-07, Aligned region: 8..93
Protein Sequence: 117 a.a.     [Download]
>gi|270208288|ref|YP_003329065.1| PrgI [Enterococcus faecalis]
MAISSEFYKDLSKVEKKIWGITVREFKAYVCFVFIGILLLLEVFFLPDLLFMVCALVTSFALGWYPVLLM
MNKWKEVKRAFYLRFYYEERTFQAGKIRRYQKNEFVQKETIKETDVI
 
Nucleotide Sequence: 354 bp     [Download]
>gi|270208272|ref|NC_013533.1|:16151-16504 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGGCGATTAGTTCAGAATTCTATAAAGATTTGTCAAAAGTAGAGAAAAAAATATGGGGAATTACAGTCA
GAGAATTTAAAGCATATGTTTGCTTTGTTTTTATAGGGATACTTCTTCTGTTAGAAGTATTTTTTTTGCC
TGATCTTTTATTTATGGTTTGTGCGTTAGTCACCTCGTTTGCGTTAGGGTGGTATCCCGTTTTATTAATG
ATGAATAAGTGGAAAGAAGTAAAAAGAGCTTTTTACTTACGTTTTTATTATGAGGAGCGAACCTTTCAGG
CTGGGAAAATAAGGAGGTATCAAAAGAATGAATTTGTTCAAAAAGAAACAATCAAAGAAACAGACGTTAT
CTAG
 Primer design