SecReT4
Protein ID: 270208289
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgJ
Locus tagpBEE99p17
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]16458..18848 [+]
ProductPrgJ
Component typePrgJ
UniProt IDD1LHF4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.5e-39, Aligned region: 459..753
Protein Sequence: 796 a.a.     [Download]
>gi|270208289|ref|YP_003329066.1| PrgJ [Enterococcus faecalis]
MNLFKKKQSKKQTLSSNVEKVDKKVKKRVQQQANPTVQESIFYTSQFEEGLMHIVEDEFSKCYKLGEVDY
EIAVEEDQLNTVMGYAEGLNTLDKNSRYQLLVVNKREEESLMEDVLLAYQGDHLDNYRQEINEIITKQYE
QDERNFKIEKYAIFTTKSSSMKQANKELEGIMQNFANRFEANQIKLEVTPMTGLERLSLFSYFLRHGQYF
GTSYQDIAVSGLTSKAFIVPSKIKFPNNKAYFRLGENYAAVLTIQQYPKYLEDKLIKELCATGRELAISI
HARPYDMMEARKAIQGTKTLNDVAIQKQQKQNFRSGVSEDAISGEAKEIQETTNALMDEIKNNGQKLFNG
LFSVFLIAETEKELLEAVESVKNVGATWQVVFDTVDNYKEEALNTILPIGKPYLDVEMSYMRDLTTTNIA
TQVPFTNVELQSPTGQFYGRNQLTKNMITIDRKKDLITPSGLIFGTSGSGKGMATKWEILSTRLKFPKDR
FLIVDPESEYLPIGKELDAEILDISTGTKNHLNILGMVDKQLLDEEDQELDLVKEKSNLLSTMFESLLKS
YTDVDAGLVDRVTLLTYERFENKETEPTLVDWFRILKEQTDEGAKELANKVETYCVGSQDIFAHQTNIDL
TAPFIVFNTKKLDDRLKKFAMKVILDQLWKQVVSGQGKVTSRLYFDELQVNFTTEEEAEWFLNLWARIRK
YGAVTTGITQNPTTLLDSKAGQKMIANSEFLILLRQKPIDSQRLVEILSLTPALKKYINDRAPQGTGLIS
AGGVVVPFENPIPKETHLFEIMNTDA
 
Nucleotide Sequence: 2391 bp     [Download]
>gi|270208272|ref|NC_013533.1|:16458-18848 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGAATTTGTTCAAAAAGAAACAATCAAAGAAACAGACGTTATCTAGTAACGTTGAAAAAGTAGATAAAA
AAGTAAAAAAACGTGTACAGCAACAAGCAAATCCTACCGTACAGGAGAGTATTTTTTATACGAGTCAGTT
TGAAGAAGGGCTCATGCACATTGTAGAGGATGAGTTTTCTAAATGCTATAAACTTGGAGAAGTGGACTAC
GAAATTGCTGTAGAAGAAGATCAATTAAACACGGTAATGGGGTATGCAGAAGGGTTAAATACACTAGACA
AAAACTCTCGGTATCAGCTGCTGGTTGTTAATAAAAGAGAGGAAGAGTCGTTGATGGAAGACGTTTTATT
GGCGTATCAGGGAGATCACTTAGATAACTACCGTCAAGAAATCAATGAAATTATTACGAAGCAGTATGAA
CAAGACGAGCGAAACTTTAAGATTGAAAAATATGCTATTTTCACCACAAAAAGTTCGTCCATGAAACAAG
CTAACAAAGAGTTAGAAGGAATCATGCAGAACTTTGCCAATCGTTTTGAAGCCAACCAAATTAAATTAGA
GGTAACCCCAATGACTGGCTTAGAGCGATTGTCTTTGTTCAGCTATTTTTTGCGCCACGGACAATATTTT
GGCACAAGCTACCAAGATATTGCCGTATCAGGGCTAACGTCTAAAGCGTTTATTGTTCCAAGTAAAATCA
AGTTTCCAAACAATAAAGCTTATTTTCGGTTAGGAGAAAACTACGCAGCTGTTTTAACCATTCAACAATA
CCCAAAATACCTAGAAGATAAGTTAATCAAAGAATTATGCGCTACAGGAAGAGAGTTAGCGATTAGCATT
CATGCCAGACCTTATGACATGATGGAAGCCAGAAAGGCAATACAGGGAACCAAGACGTTAAATGATGTTG
CCATTCAAAAGCAACAGAAGCAAAACTTCAGAAGTGGTGTTTCAGAGGATGCGATTTCAGGAGAAGCAAA
GGAAATCCAAGAAACAACGAACGCGTTAATGGATGAAATAAAAAATAATGGCCAAAAGTTATTTAATGGC
CTATTTTCAGTTTTCCTAATTGCAGAAACAGAAAAGGAACTTTTAGAAGCTGTTGAATCGGTGAAAAACG
TAGGAGCAACCTGGCAAGTTGTGTTTGATACGGTAGACAATTACAAAGAAGAAGCACTCAATACTATCTT
ACCGATTGGAAAACCTTACTTAGACGTTGAAATGAGTTATATGCGTGATCTAACAACAACAAATATTGCT
ACACAAGTACCTTTTACCAATGTGGAATTACAAAGCCCAACAGGTCAGTTTTATGGCCGGAATCAGTTGA
CGAAGAACATGATTACTATTGACCGAAAAAAAGATTTAATTACACCAAGTGGGCTTATTTTCGGAACGTC
TGGTTCTGGTAAAGGAATGGCGACCAAATGGGAAATTCTTTCAACGCGTTTAAAATTTCCGAAGGACCGC
TTTTTAATTGTTGATCCAGAAAGTGAATACTTACCGATTGGGAAAGAATTGGATGCAGAAATACTCGATA
TCTCAACTGGTACAAAAAACCACTTGAATATTTTAGGAATGGTAGACAAGCAGTTATTGGATGAAGAGGA
CCAGGAACTTGATTTAGTTAAAGAAAAATCTAATTTGTTATCCACTATGTTTGAATCGCTACTAAAAAGC
TATACGGACGTGGATGCGGGACTTGTTGACCGTGTGACGTTGTTGACGTATGAACGCTTTGAAAACAAAG
AGACAGAGCCAACATTAGTCGATTGGTTTAGAATCTTAAAAGAACAAACGGATGAAGGTGCCAAAGAATT
AGCGAATAAAGTGGAAACCTATTGTGTGGGTTCACAAGATATCTTTGCGCACCAAACGAATATCGATTTA
ACGGCACCCTTTATTGTCTTTAATACAAAAAAATTAGATGATCGCTTGAAAAAGTTTGCCATGAAAGTGA
TTTTAGATCAGTTGTGGAAACAAGTAGTATCCGGACAAGGAAAAGTAACGTCACGTTTGTATTTTGATGA
ATTACAAGTCAACTTCACAACGGAAGAAGAAGCAGAATGGTTCTTAAATTTATGGGCGCGTATTCGTAAG
TATGGCGCCGTGACAACAGGTATCACGCAAAACCCTACGACGTTATTAGACAGTAAAGCGGGGCAAAAAA
TGATTGCCAATAGTGAATTTTTGATTTTATTACGGCAAAAACCAATTGATTCACAACGATTAGTAGAAAT
TTTAAGTCTGACACCTGCATTGAAGAAGTATATCAATGATCGAGCCCCACAAGGAACGGGGCTAATTTCT
GCAGGTGGGGTGGTTGTTCCGTTTGAAAATCCTATTCCAAAAGAAACACATCTATTTGAAATTATGAATA
CCGACGCTTAG
 Primer design