SecReT4
Protein ID: 270208290
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgK
Locus tagpBEE99p18
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]18860..21373 [+]
ProductPrgK
Component typePrgK
UniProt IDD1LHF5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam CHAP [PF05257], Evalue: 3.1e-17, Aligned region: 758..833
Protein Sequence: 837 a.a.     [Download]
>gi|270208290|ref|YP_003329067.1| PrgK [Enterococcus faecalis]
MVESKRTWKEKVHVESQVEERLRKNLTLKSREATKLQKKALKTTKKEFKLSKKNYKQSLKKHKLTLKTGK
EPLSINHLLDKKKFVEQKKRKKAQKIAYKRTKKVDETRVVNQVKRETKEGLKREATQKVRTTLTQEDTLN
EAMTLYEKTQQAKFNMRTALKTGKTVKNLSVKTAKDTYGLGNRLFNFSRGRGFQRTPKDFTLKKQLMKQL
RNRAMRFKAAKEAKKAEQGIGLIRSFFNGQKTLGKVAALILKNPISWVVLLVLFLVFLLSGVASSTQKPA
IVQEEEDLTASWTYFTKLDAQHTDDNNQFYSNIDDVLFYMNYRYDDFKLLDMDSTGTKNFETILSDLWTA
LNGKKPDYQLKTMQSLETDKKSSYFIEEEQAKHYQEIKKELGYQTLDDLLSFPVKTDALIVNKRYGYDKS
KEKLTLYQGIDVLIEANQPFHSPMNGQIVSVPDTETLVIEKEKVARLTIRGVNTLRLTKGMDVEEGTFLG
NTKNSTVTFQYEKYKKDTKDWFFVNPAFYFPRVTYTQTTLLGSADFSPGASVEKRAQAVYDYLSKKGYTK
EGISAILGNFSVESGINPKRAEGDYLNPPVGAHGNSWDEPSWLSMGGPQIYGGRFPNILHRGLGLGQWTD
TADGGRRHTLLLDYAKGKNKKWYDLQLQLDFIFDGDAPGSRTAADNVARSKVAATIPELTTYFLTVWEGN
PGDKLGERIQAAQNWFTFFSRSGTPIGGSGSEVFAKYKEKMQPLPTDRETKAGQGWPGNAYAPGNCTWYV
FNRFAQLGKSIHPTMGNANQWVHNYRQTPGATLESTPKKGDAVIFTNGVAGSSTQYGHVAYVGAKRS
 
Nucleotide Sequence: 2514 bp     [Download]
>gi|270208272|ref|NC_013533.1|:18860-21373 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGGTAGAAAGTAAGCGTACTTGGAAAGAAAAAGTACATGTTGAATCTCAAGTAGAAGAGCGTCTTAGAA
AAAATTTGACCTTAAAATCAAGAGAAGCGACGAAGTTGCAAAAAAAAGCATTAAAGACGACTAAAAAGGA
GTTTAAACTTTCTAAGAAAAATTACAAGCAATCACTAAAAAAACATAAACTTACCTTGAAAACAGGGAAG
GAACCATTAAGTATTAACCATTTACTGGATAAAAAGAAATTTGTAGAGCAAAAGAAACGCAAAAAAGCAC
AGAAAATTGCTTACAAACGAACGAAAAAAGTAGATGAAACGCGTGTCGTTAACCAAGTGAAAAGGGAAAC
CAAGGAAGGGTTGAAAAGAGAAGCGACGCAAAAAGTACGAACCACGTTAACGCAGGAAGATACACTGAAT
GAAGCAATGACCCTTTATGAAAAAACACAACAAGCTAAATTTAACATGCGTACAGCTTTGAAAACAGGAA
AAACGGTTAAGAATCTTTCGGTGAAAACTGCAAAAGATACGTACGGATTGGGGAATCGCTTATTTAACTT
TTCAAGAGGACGTGGGTTTCAGCGCACACCAAAAGACTTTACGTTAAAAAAACAACTTATGAAACAACTA
CGGAATCGCGCTATGCGCTTTAAAGCAGCAAAAGAAGCGAAGAAAGCCGAACAAGGTATTGGCTTGATTC
GTTCTTTTTTTAATGGTCAGAAGACATTAGGGAAAGTCGCTGCATTGATTCTAAAAAATCCAATTTCTTG
GGTTGTTTTATTGGTTCTTTTTCTTGTTTTTTTATTGAGTGGCGTTGCAAGTAGTACACAAAAACCAGCG
ATTGTTCAAGAAGAGGAAGATTTAACCGCTTCATGGACGTATTTTACTAAATTAGATGCGCAACATACAG
ACGATAACAACCAGTTTTATAGCAATATCGATGATGTTCTTTTCTACATGAATTATCGGTACGATGATTT
TAAATTATTAGATATGGATTCCACGGGTACAAAGAATTTTGAAACGATTCTATCTGACTTATGGACGGCA
TTAAACGGAAAGAAACCTGATTATCAGTTGAAAACAATGCAAAGTTTAGAAACAGATAAGAAATCAAGTT
ATTTTATCGAAGAGGAACAAGCAAAGCATTATCAAGAGATAAAAAAAGAGTTAGGCTACCAAACATTGGA
TGATCTCCTTTCTTTTCCAGTAAAAACTGACGCTTTAATTGTCAATAAGCGCTATGGCTATGACAAATCA
AAAGAGAAGCTCACCTTGTATCAAGGCATTGATGTATTGATTGAAGCTAATCAGCCGTTTCATTCACCAA
TGAACGGCCAAATCGTTTCGGTGCCTGATACAGAAACACTGGTTATCGAAAAAGAGAAAGTAGCTAGGTT
AACGATTCGTGGTGTGAATACCCTTCGACTAACAAAAGGTATGGATGTTGAAGAAGGAACATTTCTTGGG
AATACAAAGAATTCAACAGTTACGTTCCAGTATGAAAAATATAAAAAAGATACGAAAGACTGGTTTTTTG
TAAATCCAGCCTTTTATTTTCCACGTGTAACCTACACGCAAACGACTCTTTTAGGAAGTGCAGATTTTTC
TCCTGGAGCAAGTGTCGAAAAAAGAGCGCAAGCTGTTTATGATTATTTATCAAAAAAGGGATACACCAAA
GAGGGAATTAGCGCGATTTTAGGCAATTTTTCGGTAGAAAGTGGCATTAATCCAAAACGAGCAGAAGGGG
ATTATTTGAATCCGCCTGTAGGTGCGCATGGAAATTCGTGGGACGAACCGAGTTGGCTTTCTATGGGAGG
GCCGCAAATTTATGGGGGACGTTTTCCAAATATTCTCCATCGAGGACTAGGTTTAGGTCAATGGACGGAT
ACAGCTGATGGTGGTCGTAGGCATACGTTGTTATTAGACTATGCCAAAGGTAAAAATAAAAAATGGTACG
ATCTGCAATTGCAGCTGGACTTTATTTTTGACGGCGATGCACCAGGTTCACGAACAGCAGCAGACAATGT
AGCAAGAAGTAAGGTTGCTGCAACTATTCCAGAACTTACTACTTATTTTCTAACTGTTTGGGAAGGAAAT
CCCGGAGACAAGTTAGGAGAACGAATTCAAGCTGCACAAAATTGGTTTACATTCTTTTCTCGATCAGGTA
CACCAATCGGTGGTTCTGGAAGTGAAGTCTTTGCGAAGTATAAAGAAAAAATGCAACCATTACCCACAGA
CAGAGAAACAAAAGCAGGACAAGGCTGGCCAGGCAATGCGTATGCGCCAGGGAATTGTACTTGGTATGTA
TTTAATCGTTTTGCACAGTTAGGAAAAAGCATTCACCCTACTATGGGAAACGCCAATCAATGGGTGCATA
ACTACAGACAAACACCAGGAGCGACACTTGAATCAACTCCTAAAAAAGGGGATGCTGTTATTTTTACAAA
TGGTGTAGCTGGTTCTAGTACGCAATATGGACACGTGGCTTATGTGGGTGCGAAACGTTCTTAA
 Primer design