SecReT4
Protein ID: 270208293
T4SS name [ID]Prg/Pcf [616]
Gene symbolprgL
Locus tagpBEE99p21
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]24304..24930 [+]
ProductPrgL
Component typePrgL
UniProt IDD1LHF8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 208 a.a.     [Download]
>gi|270208293|ref|YP_003329070.1| PrgL [Enterococcus faecalis]
MYNMEKLSRYKKIAFIGGSLLLIVIIFLIGLSVGQRKQVNTNEKQVKVEKKEELTTSTVKKFLIAYYTKK
DLGENRNRYEPLVTSAMYNELVNVEKQPVNQAYKGYVVNQVLDTYKIYIDTENNEVIVDVTYKNTQRTKR
NNDEGALKNQSNQEALKLTFVKQGANFLVDKMAPVTLTNELQEEPNSYNTHVVTTEESAKESANSGEK
 
Nucleotide Sequence: 627 bp     [Download]
>gi|270208272|ref|NC_013533.1|:24304-24930 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGTATAATATGGAAAAATTAAGTAGATACAAGAAAATTGCCTTTATTGGTGGCAGCTTACTGCTTATTG
TGATTATTTTTTTGATTGGGCTTAGTGTTGGGCAAAGAAAACAAGTAAACACCAATGAAAAACAAGTAAA
AGTTGAGAAAAAAGAGGAATTAACAACAAGTACGGTAAAAAAATTTTTGATTGCGTATTATACAAAAAAA
GATCTTGGTGAAAATAGAAATCGCTATGAACCTTTGGTGACAAGCGCCATGTATAACGAATTAGTGAATG
TAGAAAAACAGCCTGTTAATCAAGCGTATAAAGGCTATGTAGTCAATCAAGTACTTGATACGTATAAAAT
CTATATTGATACTGAAAACAACGAAGTCATTGTGGACGTCACGTATAAGAATACACAACGAACCAAACGA
AATAATGATGAAGGAGCGTTGAAAAATCAGAGCAATCAAGAAGCGCTGAAATTAACCTTTGTAAAACAAG
GCGCTAATTTTTTAGTGGATAAAATGGCACCAGTAACACTTACCAATGAATTACAAGAGGAGCCAAATTC
ATATAATACACATGTAGTAACGACAGAAGAATCAGCAAAGGAGAGTGCAAACAGTGGGGAAAAGTAA
 Primer design