SecReT4
Protein ID: 270208300
T4SS name [ID]Prg/Pcf [616]
Gene symbolpcfC
Locus tagpBEE99p28
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]27852..29681 [+]
ProductPcfC
Component typePcfC
UniProt IDD1LHG5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 3.5e-48, Aligned region: 144..558
TraG-D_C [PF12696], Evalue: 1e-31, Aligned region: 414..529
TrwB_AAD_bind [PF10412], Evalue: 4.8e-15, Aligned region: 415..543
AAA_10 [PF12846], Evalue: 2.2e-08, Aligned region: 143..488
Protein Sequence: 609 a.a.     [Download]
>gi|270208300|ref|YP_003329077.1| PcfC [Enterococcus faecalis]
MQTYKKELKPYLYLGIFLFVIGFGIGNFFWLLPGTDYFSKTNYLFTKDILTYIEQTFYRFFITPSLLGFS
VGILGFLLGLLMYVRDNDRGIYRHGEEYGSARFATPAEMKKYEDPIPENNIIVSKHVKISLFNKRLPIKL
QKNKNIAILGDSGAAKTLAFIKTNLMQRHASFITTDPDGGILPEIGLLLKKGKYKIKVLDLNTLSNSDTF
NVFEYMHSELDVDRVLEAVTEATKEVEKTTGDDFWIKAEGLLVRSLIAYLWFDGRRNDYTPHLGMIADML
RHLKRKDKNVPSPVEEWFEELNEAIPDNYAYRQWTLFNNLYESETRASVLGIAAARYSVFDHEEVVNMIR
TDTMDIDSWNEEKTAVFIAIPETNTSFNFIAALMFATVGEVLRNKSDQVRLGKRVLEEGKELLHVRFLID
EFANIGRIPHFEKMLTTFRKREMSFTIVLQSLNQLQTLYPKGWQNILNGCACLLYLGGDEEETTKYLSAR
AGKQTLSIRKHSMNKGNQGGGSENRDKYGRDLIDRSEVALIGGDECLVFISKEHVFKDKKFYAFQHDRAD
ELATGPTDDKWYTWCRYMTDEEAILDKISATDIIDHGEITSELKDETHV
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|270208272|ref|NC_013533.1|:27852-29681 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGCAGACGTACAAAAAAGAACTGAAACCGTATCTCTACCTTGGTATTTTTCTATTTGTGATTGGCTTTG
GAATAGGAAATTTCTTTTGGCTGTTACCAGGGACAGACTATTTTTCAAAAACGAATTATCTCTTTACAAA
AGACATTCTGACGTATATCGAACAAACTTTTTATCGGTTTTTTATAACACCAAGTCTATTAGGATTTAGT
GTAGGAATACTTGGTTTTCTTTTAGGGCTATTAATGTATGTGCGAGATAATGATCGTGGAATCTACCGTC
ATGGAGAAGAATACGGTTCGGCTCGTTTTGCTACACCTGCTGAAATGAAAAAATATGAAGATCCAATTCC
TGAAAACAATATTATTGTTAGTAAGCATGTAAAAATTTCTCTTTTTAATAAACGTTTACCAATCAAGCTA
CAAAAAAATAAGAATATCGCCATTCTAGGTGACTCTGGAGCGGCTAAAACGTTAGCTTTTATCAAAACCA
ATCTTATGCAACGACATGCCAGCTTTATCACAACAGACCCAGACGGTGGGATATTGCCAGAGATTGGACT
TTTATTGAAAAAAGGAAAGTACAAGATTAAGGTCTTAGACTTAAACACGTTGTCAAATAGTGATACGTTC
AATGTTTTTGAGTATATGCACTCCGAATTAGACGTGGACCGAGTTTTAGAAGCTGTCACCGAAGCAACAA
AAGAAGTGGAAAAAACGACCGGGGACGATTTTTGGATAAAAGCCGAAGGCTTATTGGTTCGCTCTCTTAT
TGCGTATTTATGGTTTGACGGTCGCAGAAATGATTATACGCCACATTTAGGAATGATTGCGGACATGTTA
CGCCACCTAAAACGAAAAGATAAAAATGTACCTAGCCCAGTGGAAGAATGGTTTGAGGAGTTAAACGAGG
CCATTCCTGACAACTACGCTTACCGACAATGGACCTTGTTTAACAATTTGTATGAGAGTGAAACGAGAGC
CAGCGTTCTAGGGATAGCTGCTGCACGTTACTCTGTTTTTGACCATGAAGAAGTGGTCAATATGATTCGT
ACAGACACGATGGATATTGACTCCTGGAATGAAGAAAAAACAGCGGTGTTTATTGCGATACCTGAAACTA
ATACGTCGTTTAATTTTATTGCAGCGTTGATGTTTGCGACAGTCGGAGAAGTGTTGCGAAATAAATCAGA
CCAAGTACGTTTAGGAAAACGAGTACTAGAAGAAGGAAAAGAACTCCTACATGTCCGCTTCTTAATTGAC
GAATTTGCCAATATTGGCCGAATTCCTCACTTTGAGAAAATGTTGACCACGTTTCGTAAGCGAGAAATGT
CGTTTACCATTGTTTTACAATCCTTAAATCAACTCCAAACCTTGTATCCAAAAGGGTGGCAAAACATTTT
AAATGGCTGTGCGTGTTTACTATACCTTGGTGGAGACGAAGAAGAAACCACCAAGTATCTGTCTGCGCGT
GCAGGGAAACAAACGTTATCTATTCGGAAACATAGCATGAACAAAGGAAATCAAGGTGGAGGATCTGAAA
ATCGCGATAAATACGGGCGCGATTTGATTGACAGGAGTGAAGTTGCGCTTATCGGAGGAGACGAATGCCT
GGTTTTTATATCAAAAGAGCATGTTTTTAAAGATAAAAAATTCTATGCTTTTCAGCATGACCGAGCAGAT
GAACTAGCAACAGGACCGACTGATGATAAGTGGTATACGTGGTGCCGATATATGACTGATGAAGAAGCTA
TTTTGGATAAAATCTCGGCAACAGATATTATTGACCATGGAGAAATTACAAGTGAACTGAAAGACGAAAC
ACACGTTTAA
 Primer design