SecReT4
Protein ID: 270208305
T4SS name [ID]Prg/Pcf [616]
Gene symbolpcfH
Locus tagpBEE99p33
StrainEnterococcus faecalis plasmid pBEE99 (NC_013533)
Repliconplasmid pBEE99 [GenBank: NC_013533] [Browse all T4SS(s) in this replicon]
Location [Strand]34517..34867 [+]
ProductPcfH
Component typePcfH
UniProt IDD1LHH0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 116 a.a.     [Download]
>gi|270208305|ref|YP_003329082.1| PcfH [Enterococcus faecalis]
MLILKRGLSVVLFLPCFILRILFRYIGLLTILTSGFTTTLILIVARILAFIFLVYPIVILTTEELRMEWA
SWIAWLLFGLIVLFFHYLAAWNEDLGSWFLDFSNWLSRVPSKLWAE
 
Nucleotide Sequence: 351 bp     [Download]
>gi|270208272|ref|NC_013533.1|:34517-34867 Enterococcus faecalis plasmid pBEE99, complete sequence
ATGCTTATTTTGAAACGAGGATTGTCTGTAGTGTTATTTTTACCCTGTTTTATTCTACGTATTCTTTTCC
GTTACATTGGACTGTTAACGATTCTTACTAGTGGTTTTACTACCACTTTAATACTAATCGTTGCTCGAAT
TTTAGCTTTTATTTTTTTAGTTTACCCGATTGTGATTTTAACAACTGAAGAACTTAGAATGGAATGGGCA
AGTTGGATTGCTTGGCTTTTATTTGGATTGATCGTTCTATTTTTCCATTATCTAGCTGCGTGGAACGAAG
ACTTAGGCAGTTGGTTTCTGGATTTTTCTAATTGGTTGAGCAGGGTACCAAGTAAACTGTGGGCTGAATA
A
 Primer design