SecReT4
Protein ID: 270208420
T4SS name [ID]Tra_F [85]
Gene symboltraX
Locus tagpKF370p23
StrainKlebsiella pneumoniae plasmid pKF3-70 (NC_013542)
Repliconplasmid pKF3-70 [GenBank: NC_013542] [Browse all T4SS(s) in this replicon]
Location [Strand]18651..19397 [-]
ProductTraX
Component typeTraX_F
UniProt IDD2D9B4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraX [PF05857], Evalue: 6.4e-53, Aligned region: 32..247
Protein Sequence: 248 a.a.     [Download]
>gi|270208420|ref|YP_003329194.1| TraX [Klebsiella pneumoniae]
MTTDNTNTTRNDSLAARTDTWLQSFLVWSPGQRDIIKTVALVLMVLDHINLIFQLKQEWMFLAGRGAFPL
FALVWGLNLSRHAHIRQPAINRLWGWGIIAQFAYYLAGFPWYEGNILFAFAVAAQVLTWCETRSGWRTAA
AILLMALWGPLSGTSYGIAGLLMLAVSYRLYRAEDRAERLALLACLLAVIPALNLASSDAAAVAGLVMTV
LTVGLVSCAGKSLPRFWPGDFFPVFYACHLAVLGVLAL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|270208397|ref|NC_013542.1|:c19397-18651 Klebsiella pneumoniae plasmid pKF3-70, complete sequence
ATGACAACGGATAACACGAACACGACACGTAACGATTCACTGGCTGCACGGACCGATACCTGGTTGCAGT
CGTTTCTGGTCTGGTCACCCGGACAGCGGGATATCATCAAAACGGTGGCGCTGGTGCTGATGGTACTGGA
CCACATCAATCTGATATTCCAGCTGAAGCAGGAATGGATGTTTCTGGCCGGGCGAGGAGCCTTTCCGCTG
TTTGCCCTGGTGTGGGGGCTGAATCTGTCCCGTCATGCGCATATCCGGCAACCGGCCATTAACCGGCTGT
GGGGATGGGGAATTATTGCCCAGTTCGCATATTATCTGGCCGGCTTTCCCTGGTATGAGGGGAATATCCT
GTTTGCCTTTGCAGTGGCGGCACAGGTGCTGACGTGGTGTGAAACGCGCAGTGGGTGGCGTACAGCAGCG
GCCATTCTTCTGATGGCCCTGTGGGGGCCTTTGTCCGGCACCAGTTACGGCATTGCCGGGCTGCTGATGC
TGGCGGTCAGTTACCGACTGTACCGGGCGGAAGACAGAGCGGAACGTCTGGCGCTGCTTGCATGCCTGCT
GGCCGTTATTCCGGCACTTAACCTTGCCTCCAGTGATGCAGCGGCGGTGGCCGGTCTTGTAATGACGGTG
CTGACCGTTGGTCTGGTGTCGTGTGCAGGAAAATCATTACCCCGTTTCTGGCCCGGGGATTTTTTCCCGG
TATTCTACGCCTGTCATCTGGCTGTGCTGGGCGTTCTGGCGTTGTGA
 Primer design