SecReT4
Protein ID: 270208431
T4SS name [ID]Tra_F [85]
Gene symboltraQ
Locus tagpKF370p34
StrainKlebsiella pneumoniae plasmid pKF3-70 (NC_013542)
Repliconplasmid pKF3-70 [GenBank: NC_013542] [Browse all T4SS(s) in this replicon]
Location [Strand]34464..34748 [-]
ProductTraQ
Component typeTraQ_F
UniProt IDD2D9C5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraQ [PF09679], Evalue: 1.4e-49, Aligned region: 2..94
Protein Sequence: 94 a.a.     [Download]
>gi|270208431|ref|YP_003329205.1| TraQ [Klebsiella pneumoniae]
MISKRRFSLPRLDITGMWVFSLGVWFHIVARLVYSKPWMAFFLAELIAAILVLFGAYQVLDAWIARVSLE
EREALEARQQAMMEGQQEGGHVSH
 
Nucleotide Sequence: 285 bp     [Download]
>gi|270208397|ref|NC_013542.1|:c34748-34464 Klebsiella pneumoniae plasmid pKF3-70, complete sequence
ATGATAAGTAAACGCAGATTCTCTTTACCCCGGCTTGATATTACGGGAATGTGGGTATTTTCCCTGGGTG
TCTGGTTTCATATCGTCGCCCGTCTTGTTTACAGCAAACCCTGGATGGCTTTTTTTCTGGCGGAGTTGAT
TGCGGCCATCCTTGTGCTGTTCGGCGCATACCAGGTGCTGGATGCATGGATTGCACGTGTCAGCCTGGAA
GAGCGTGAGGCACTGGAAGCCAGGCAACAGGCCATGATGGAAGGGCAGCAGGAGGGCGGACATGTCTCTC
ACTAA
 Primer design