SecReT4
Protein ID: 270208434
T4SS name [ID]Tra_F [85]
Gene symboltraF
Locus tagpKF370p37
StrainKlebsiella pneumoniae plasmid pKF3-70 (NC_013542)
Repliconplasmid pKF3-70 [GenBank: NC_013542] [Browse all T4SS(s) in this replicon]
Location [Strand]35500..36243 [-]
Productconjugal transfer protein TraF
Component typeTraF_F
UniProt IDD2D9C8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 5.9e-79, Aligned region: 23..237
Protein Sequence: 247 a.a.     [Download]
>gi|270208434|ref|YP_003329208.1| conjugal transfer protein TraF [Klebsiella pneumoniae]
MNKALLPLLLCCFIFPASGKDAGWQWYNEKINPKEKENKPVPAAPRQEPDIMQKLAALQTATKRALYEAI
LYPGVDNFVKYFRLQNYWTQQAGLFTMSAKKAMLAHPELDYNLQYSHYNGTVRNQLAADQAQQRQAIAKL
AEHYGIMFFYRGQDPIDGQLAQVINGFRDTYGLSVIPVSVDGVINPLLPDSRTDQGQAQRLGVKYFPAMM
LVDPKQGSVRPLSYGFISQDDLAKQFLNVSEDFKPNF
 
Nucleotide Sequence: 744 bp     [Download]
>gi|270208397|ref|NC_013542.1|:c36243-35500 Klebsiella pneumoniae plasmid pKF3-70, complete sequence
ATGAATAAAGCATTACTGCCACTGTTACTCTGCTGCTTTATTTTTCCGGCGTCAGGGAAAGATGCAGGCT
GGCAGTGGTATAACGAGAAAATAAATCCGAAGGAAAAAGAAAATAAACCTGTACCTGCAGCCCCCCGTCA
GGAGCCGGATATTATGCAGAAACTGGCCGCGCTGCAGACGGCAACAAAGCGGGCGCTGTACGAAGCCATT
CTGTATCCCGGCGTGGATAATTTTGTTAAATATTTCCGGCTGCAGAATTACTGGACTCAGCAGGCCGGGC
TTTTCACCATGAGTGCTAAAAAGGCCATGCTGGCACATCCCGAACTGGACTATAACCTGCAGTACAGCCA
TTACAACGGCACGGTACGGAACCAGCTGGCGGCAGACCAGGCGCAGCAGCGACAGGCCATTGCGAAACTG
GCTGAACACTACGGCATCATGTTTTTTTACCGGGGGCAGGACCCCATCGACGGGCAACTGGCGCAGGTCA
TTAATGGCTTCCGGGATACGTATGGTCTGAGTGTTATTCCCGTTTCCGTGGATGGCGTGATTAATCCGCT
GTTGCCGGATTCCCGGACTGACCAGGGGCAGGCGCAGCGCCTCGGTGTGAAATATTTCCCGGCCATGATG
CTGGTTGACCCGAAACAGGGCAGTGTTCGCCCGTTATCATACGGCTTTATTTCACAGGACGACCTGGCAA
AACAGTTCCTGAACGTTTCTGAAGATTTTAAACCGAATTTTTAA
 Primer design