SecReT4
Protein ID: 270208453
T4SS name [ID]Tra_F [85]
Gene symboltraL
Locus tagpKF370p56
StrainKlebsiella pneumoniae plasmid pKF3-70 (NC_013542)
Repliconplasmid pKF3-70 [GenBank: NC_013542] [Browse all T4SS(s) in this replicon]
Location [Strand]49752..50063 [-]
Producthypothetical protein
Component typeTraL_F
UniProt IDD2D9E7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 3.2e-37, Aligned region: 9..103
Protein Sequence: 103 a.a.     [Download]
>gi|270208453|ref|YP_003329227.1| hypothetical protein pKF370p56 [Klebsiella pneumoniae]
MSGDENKLKKYRFPETLTNQSRWFGLPLDELIPAAICIGWGIITSKYLFGIGAAVLVYFGIKKLKKGRGS
SWLRDLIYWYMPTALLRGIFHNVPDSCFRQWIK
 
Nucleotide Sequence: 312 bp     [Download]
>gi|270208397|ref|NC_013542.1|:c50063-49752 Klebsiella pneumoniae plasmid pKF3-70, complete sequence
ATGTCGGGAGACGAGAATAAACTTAAGAAATATCGTTTCCCGGAAACACTGACCAACCAGAGCCGCTGGT
TTGGCCTGCCACTGGATGAACTGATCCCCGCAGCAATCTGTATTGGCTGGGGTATCATAACATCGAAATA
TCTGTTCGGTATTGGTGCAGCGGTTCTGGTTTATTTCGGGATTAAAAAACTGAAAAAAGGGCGGGGCAGT
TCCTGGTTACGTGACCTGATTTACTGGTATATGCCAACAGCCCTGCTGCGCGGTATTTTTCATAATGTTC
CCGATTCGTGTTTCCGGCAGTGGATTAAATAG
 Primer design