SecReT4
Protein ID: 271499998
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1450
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1646994..1648856 [-]
Productmobilization protein
Component typeVirD4
UniProt IDD2BWT4
KEGG IDddc:Dd586_1450
PDB IDNA
Domain hit(s) vs Pfam TrwB_AAD_bind [PF10412], Evalue: 1.6e-09, Aligned region: 396..541
T4SS-DNA_transf [PF02534], Evalue: 4.3e-09, Aligned region: 321..535
AAA_10 [PF12846], Evalue: 8.7e-09, Aligned region: 194..479
TraG-D_C [PF12696], Evalue: 2e-07, Aligned region: 400..526
Protein Sequence: 620 a.a.     [Download]
>gi|271499998|ref|YP_003333023.1| mobilization protein [Dickeya dadantii Ech586]
MLLNKLAVSLSPIVNGMLALLVFTQQHQLMLALLSGLTLPFFASMKSDERQSAPFWKKGIIAFSLLCFLF
GTMAPVIIRFFQWVYQTRIATRYSLATWPILIILTATGIIFHIILRRALNPELDKIKKRLVKKTTLEREL
RTDVRTVRSLLPETLHYDPLDYIDLNNGIFLGTDRDTQPMYLPLNDWQKQHADIIGTTGAGKGVAAGILL
YQSILAGEGVFIMDPKDDEWAPHLYRKACEDAGKPFALIDLRKPHYQLNLIEAITADELEELFVAGFSLA
EKGQESDFYRISDRKAARIVAQFVSNRPFSTIRDIYNSEYVQSIAEKIKAFFGKLEELALLNAINAPTGF
SLQSVFDEGGCCYVIGSMRNSKIIAAQRMLLVRLYQLAERRDRVHIAPRPVAIFLDELKYHLSKPALEGL
GAARDKGVHIIMAHQSVADLKDCPADLKGDAVVGAVVENAKFKLVYRVMDPDTAEWVARMSGTILVDDEI
RKAKTDAVLTETIDGERTIRQAERFFIDSNMILNLPDFVSFIFTTRTLPSASLISPIKVQKRELEIYSVS
PDIAASAVPAKIALDFDEEGATSASTTNVAATHPDLFFEGESKSAKPRSDDDETPSLLNF
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1648856-1646994 Dickeya dadantii Ech586 chromosome, complete genome
ATGCTGTTAAATAAGCTTGCCGTTTCACTGTCGCCGATAGTGAACGGAATGCTGGCACTGCTCGTTTTTA
CGCAACAGCATCAACTGATGCTGGCGTTATTATCGGGGCTGACGTTACCGTTTTTCGCATCAATGAAAAG
CGACGAACGACAATCAGCCCCATTCTGGAAAAAGGGAATTATCGCTTTTTCTCTGCTGTGTTTTCTGTTT
GGCACCATGGCCCCGGTGATCATCAGGTTCTTTCAGTGGGTCTATCAGACCAGAATAGCCACCCGGTATT
CGCTGGCAACCTGGCCGATACTGATTATCCTCACGGCAACAGGGATTATCTTCCATATTATTCTGCGTCG
GGCATTAAATCCTGAACTGGATAAAATAAAGAAACGCCTGGTTAAAAAAACCACCCTTGAGCGGGAATTA
CGCACCGATGTGCGCACCGTGAGATCATTGCTGCCGGAAACGCTGCATTATGATCCGCTGGATTATATTG
ATTTGAATAACGGTATTTTTCTCGGCACGGACCGGGATACGCAACCAATGTATCTCCCGTTAAACGACTG
GCAAAAACAGCACGCGGATATTATCGGCACCACCGGCGCTGGAAAAGGGGTGGCCGCCGGGATATTGCTT
TATCAAAGTATCCTGGCGGGCGAAGGGGTATTTATTATGGACCCGAAAGACGATGAATGGGCCCCACACC
TTTACCGCAAAGCCTGTGAGGATGCAGGCAAACCGTTTGCCTTAATTGACCTGCGAAAACCGCATTACCA
GCTAAACCTGATTGAAGCGATTACCGCCGATGAACTGGAAGAGCTTTTTGTCGCAGGGTTCAGTCTGGCA
GAGAAAGGCCAGGAATCTGACTTTTACCGTATCAGCGACAGAAAAGCGGCACGTATAGTGGCGCAATTTG
TCAGCAACCGCCCTTTTTCGACTATCCGTGATATTTATAACAGCGAGTATGTTCAGAGTATCGCTGAGAA
GATCAAAGCGTTTTTCGGCAAGCTTGAAGAGCTGGCGTTACTCAATGCCATCAATGCGCCGACCGGATTT
TCACTCCAATCAGTTTTTGATGAAGGTGGCTGCTGTTATGTCATCGGCTCAATGCGCAACAGCAAGATAA
TTGCCGCACAGCGCATGTTGCTGGTTCGCCTTTATCAGTTAGCGGAGCGGCGCGACCGGGTACACATCGC
ACCCCGCCCTGTGGCTATTTTTCTTGATGAACTGAAATACCATTTATCCAAACCGGCCCTGGAAGGATTG
GGCGCTGCACGGGATAAAGGTGTGCATATTATTATGGCCCATCAGTCCGTGGCCGATTTAAAAGACTGCC
CGGCAGATTTAAAAGGCGATGCTGTTGTCGGTGCAGTCGTTGAAAACGCTAAATTCAAGCTGGTATACCG
CGTTATGGACCCGGATACAGCGGAATGGGTAGCGAGAATGTCTGGCACCATCTTAGTGGATGATGAAATC
CGCAAAGCCAAAACTGATGCCGTACTGACGGAAACCATCGACGGTGAACGAACTATCAGACAGGCAGAGC
GTTTCTTTATCGACAGCAATATGATCCTGAACCTGCCCGACTTTGTCAGCTTTATCTTTACGACGAGAAC
GCTTCCCTCCGCCTCACTGATTTCCCCCATTAAGGTACAAAAACGCGAACTGGAGATCTATTCCGTGTCT
CCGGATATTGCCGCGTCGGCAGTACCGGCAAAAATCGCGCTGGACTTCGACGAGGAAGGAGCGACATCCG
CTTCAACGACCAATGTCGCGGCAACCCACCCTGATCTTTTCTTTGAAGGGGAAAGTAAATCAGCAAAACC
GAGATCTGATGATGACGAAACACCGTCCTTGCTCAATTTTTAG
 Primer design