SecReT4
Protein ID: 271500000
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1452
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1650136..1651152 [-]
ProductSigma 54 interacting domain-containing protein
Component typeVirB11
UniProt IDD2BWT6
KEGG IDddc:Dd586_1452
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 3.6e-48, Aligned region: 17..310
Protein Sequence: 338 a.a.     [Download]
>gi|271500000|ref|YP_003333025.1| Sigma 54 interacting domain-containing protein [Dickeya dadantii Ech586]
MNAENLSLDFMKNQLFGEFLPLAGLTEIAINRPGEIHTKINGRWQRHESPVTLRQCHAFANALASWHDDN
IDDTSPILSATLESGERIQAIIPPACERNTVSITLRKPSYAQKTHQSWIEAGFYHRVTGQEQAESKDEEL
TRYYNNGDIPRFIEKAVEYGKTLFIVGETGAGKTTYMKTLLHYIPSHLRLTTIEDNPEIRFYHHTNYVHL
FYPAEATDEAIITPGRLIRANYRMNPDRILLAEIRGREAWDALKIIGSGHEGLITSLHAGSPEECIEGLI
DRCYENPDCHNIPFDVLLRKVLKSIDVIVSIDIHGDVRRMSDIYFKPVHLHHMKEIFR
 
Nucleotide Sequence: 1017 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1651152-1650136 Dickeya dadantii Ech586 chromosome, complete genome
ATGAACGCTGAAAACCTGTCGCTGGATTTTATGAAAAACCAGTTATTTGGTGAATTTCTACCCCTGGCAG
GCCTGACGGAAATCGCCATTAACCGCCCCGGCGAGATCCACACCAAAATAAACGGTCGATGGCAGAGGCA
TGAATCGCCGGTCACCTTGCGCCAGTGCCATGCCTTTGCCAACGCGCTGGCCTCATGGCATGACGATAAT
ATTGATGACACGTCGCCAATTCTGTCCGCCACGCTGGAGTCCGGCGAACGCATTCAGGCCATTATTCCCC
CGGCTTGCGAGCGGAATACCGTGTCCATTACGCTGCGCAAACCGTCATATGCGCAGAAAACGCATCAGTC
GTGGATTGAGGCGGGCTTTTATCACCGCGTAACCGGTCAGGAGCAGGCTGAAAGCAAGGACGAGGAACTG
ACCCGCTATTACAACAACGGGGACATCCCCCGCTTTATTGAAAAAGCCGTCGAGTACGGCAAAACGCTCT
TTATTGTGGGGGAAACCGGCGCGGGTAAAACCACCTACATGAAGACGTTGCTGCACTATATTCCGTCGCA
TCTCAGGCTGACGACAATTGAAGACAACCCCGAAATCCGGTTTTACCACCACACCAATTATGTGCATCTG
TTTTACCCGGCAGAGGCCACCGACGAGGCGATTATCACCCCCGGCAGGCTGATACGGGCGAATTATCGAA
TGAACCCGGACAGAATTCTGCTGGCGGAAATTCGCGGGCGGGAAGCGTGGGATGCGCTGAAAATTATCGG
CTCCGGCCATGAAGGGCTAATTACCTCCCTGCACGCGGGCAGCCCGGAAGAGTGTATTGAGGGACTCATC
GACCGCTGCTATGAAAACCCGGACTGCCACAATATCCCGTTCGATGTGCTGTTACGCAAGGTGCTAAAAA
GCATTGATGTAATCGTCAGCATTGATATTCATGGCGACGTCCGCCGGATGAGCGATATTTATTTTAAACC
GGTACACCTTCATCACATGAAGGAAATATTCAGATAG
 Primer design