SecReT4
Protein ID: 271500002
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1454
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1652347..1653237 [-]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDD2BWT8
KEGG IDddc:Dd586_1454
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 5.1e-53, Aligned region: 29..274
Protein Sequence: 296 a.a.     [Download]
>gi|271500002|ref|YP_003333027.1| P-type conjugative transfer protein VirB9 [Dickeya dadantii Ech586]
MLKNTVLIGLMLASCAVWGAAIPRGSAYDSRIQHVTYDSQNATVVNTRPGYLTTLLFDDDEAVLDAQTGF
PKGWRVTKSDNRVDVSPNPVIQPVTEDNGNNVNKVFLPTAKEWKTNLLVVTSKRDYSLELNVLDNDSPSQ
AFIIRFHYPDEARRQSAAADAAHLQRLREAQEKQQIAAAFEQATTPRNWRYTKRVAADSAAIAPDFAYDD
GRFITLGFSATKILPSLFRVVNQQEQTVTPLITKHGNYTVMVVQAMSPHLVLRYGRAVVGIENTAFGNVA
VSAGDTVSPAVTLEAK
 
Nucleotide Sequence: 891 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1653237-1652347 Dickeya dadantii Ech586 chromosome, complete genome
ATGCTGAAGAACACCGTACTGATAGGGCTGATGCTGGCGTCGTGCGCCGTCTGGGGGGCCGCGATACCAC
GCGGCAGCGCGTATGACAGCCGCATACAGCATGTCACCTATGACAGCCAGAATGCCACCGTCGTCAACAC
CCGCCCCGGCTACCTCACCACGCTCCTGTTCGATGACGATGAAGCGGTGCTCGACGCCCAGACCGGTTTT
CCCAAAGGCTGGCGAGTGACCAAAAGCGATAACCGGGTGGACGTCAGCCCTAACCCTGTCATCCAGCCGG
TAACGGAGGACAACGGCAATAACGTCAACAAGGTGTTTCTGCCGACCGCCAAAGAGTGGAAAACCAACCT
GTTGGTGGTGACATCCAAACGTGATTACAGTCTGGAGCTTAACGTGCTGGATAACGACTCGCCCTCGCAG
GCCTTCATTATCCGTTTTCACTATCCCGATGAAGCGCGCAGGCAATCAGCCGCCGCCGATGCCGCCCACC
TGCAACGCCTGCGTGAGGCACAGGAAAAGCAACAGATTGCGGCCGCTTTCGAGCAGGCCACCACACCGCG
AAACTGGCGCTATACCAAGCGGGTCGCGGCGGACTCGGCAGCGATTGCACCGGATTTTGCCTACGATGAT
GGCCGCTTTATCACCCTCGGCTTTTCAGCCACCAAAATCCTGCCGTCACTGTTTCGGGTCGTTAACCAGC
AGGAACAAACCGTCACGCCCCTAATCACCAAACACGGGAACTACACCGTGATGGTCGTGCAGGCCATGTC
GCCGCATCTGGTGTTGCGTTATGGCCGCGCGGTGGTCGGCATTGAGAATACCGCATTCGGCAACGTCGCC
GTCAGCGCTGGTGACACCGTTTCGCCCGCCGTCACGCTGGAGGCCAAATGA
 Primer design