SecReT4
Protein ID: 271500003
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1455
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1653237..1653920 [-]
ProductVirB8 family protein
Component typeVirB8
UniProt IDD2BWT9
KEGG IDddc:Dd586_1455
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 3.4e-50, Aligned region: 11..223
Protein Sequence: 227 a.a.     [Download]
>gi|271500003|ref|YP_003333028.1| VirB8 family protein [Dickeya dadantii Ech586]
MSETENLIASSRTFEAVLLEKDEREKKRAWRMAATGFALAALTITALIILLPLKTTDIELWSVDKQTGRY
EYMTRLKEKDIATETALAHALSAQYVRLREGYNYFSLQRDYDDVQLFNSDSVNRDYLDEFNGSQAPDVMF
NKAEYVVSVEIISNIHAPATAPDHLATLRVKRIIRRIADNTVKTDIWNIRLTYRYLPRKQLTDSQREVNP
LGFIVTSYQRDKELRGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1653920-1653237 Dickeya dadantii Ech586 chromosome, complete genome
ATGTCTGAAACAGAAAACCTCATTGCGTCATCCCGCACCTTTGAAGCGGTTCTGCTGGAAAAGGATGAAC
GGGAAAAAAAGCGCGCGTGGCGCATGGCGGCAACCGGGTTTGCGCTGGCAGCGCTGACGATAACCGCGCT
GATTATCCTGCTGCCGCTGAAAACCACCGACATCGAATTATGGTCGGTGGATAAACAGACCGGGCGCTAT
GAATACATGACCCGTCTCAAGGAGAAGGATATCGCTACCGAAACAGCGCTGGCTCATGCGCTATCCGCCC
AGTATGTCCGGCTGCGCGAAGGCTATAACTATTTTTCGCTTCAGCGCGATTATGACGACGTGCAGCTCTT
CAACAGCGACAGCGTGAACCGGGATTACCTCGACGAGTTTAACGGCAGTCAGGCCCCCGACGTCATGTTC
AATAAAGCGGAATACGTCGTGTCTGTCGAGATTATTTCCAACATTCACGCCCCCGCCACCGCCCCTGACC
ACCTTGCAACCTTGCGAGTTAAACGCATAATCCGCCGCATTGCGGATAACACGGTCAAAACGGATATCTG
GAACATCCGCCTGACTTACCGCTACCTCCCCCGCAAACAACTGACGGACAGCCAGCGAGAAGTGAACCCA
TTGGGGTTCATCGTCACCAGCTACCAGCGCGATAAAGAACTGAGGGGGGAGTGA
 Primer design