SecReT4
Protein ID: 271500006
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1458
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1655416..1656132 [-]
Producttype IV secretion system family protein
Component typeVirB5
UniProt IDD2BWU2
KEGG IDddc:Dd586_1458
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 5e-38, Aligned region: 22..221
Protein Sequence: 238 a.a.     [Download]
>gi|271500006|ref|YP_003333031.1| type IV secretion system family protein [Dickeya dadantii Ech586]
MQTRYLFLAFSLWLSAPAISAGIPVFDAVNNAESINQWMQKLKQWQETVTHYKDELDAYKQQLATATGIR
DIQGFLREAKSLKDDIDALRKNGISLDDLLTNPDGSYSSALQGLYKKYQSFDSCNPSRASLRYQDSCKQL
LLNQALAIENTREVQDRMTGTLNDIADLSDRIANAKDSKESQDLANAVAAKSVQLNALTSQWEMSVRQTE
QRATLLEQQRQNAFNEQQLAAPVPDFNH
 
Nucleotide Sequence: 717 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1656132-1655416 Dickeya dadantii Ech586 chromosome, complete genome
ATGCAAACCCGATATCTCTTCCTGGCGTTCTCGCTCTGGCTGTCCGCACCGGCGATAAGTGCCGGTATCC
CGGTGTTTGATGCCGTCAACAATGCCGAGTCGATTAATCAATGGATGCAAAAACTCAAACAATGGCAGGA
AACCGTTACCCACTATAAAGACGAGCTGGATGCTTATAAACAGCAATTGGCGACGGCAACAGGGATACGA
GATATTCAGGGGTTTCTCCGCGAGGCAAAAAGCCTGAAAGACGATATCGACGCGCTTCGCAAGAACGGTA
TTTCACTGGATGACCTGCTGACCAATCCAGACGGTTCCTATTCTTCCGCGCTTCAGGGGTTATATAAAAA
ATACCAATCGTTTGATAGCTGTAACCCGTCCCGCGCATCCCTGCGTTATCAGGACAGTTGCAAACAGCTG
TTACTCAATCAGGCACTGGCGATTGAGAATACCCGTGAGGTTCAGGACAGGATGACGGGCACGTTGAACG
ACATCGCAGACCTGTCTGACCGCATCGCCAATGCCAAAGATTCGAAAGAGTCACAGGACCTGGCGAATGC
CGTCGCGGCCAAAAGCGTGCAACTGAACGCCCTGACCAGCCAGTGGGAGATGTCTGTCCGGCAGACGGAA
CAGCGGGCAACACTGCTGGAGCAGCAACGGCAAAATGCATTCAATGAGCAGCAACTTGCCGCACCGGTTC
CCGATTTTAATCATTGA
 Primer design