SecReT4
Protein ID: 271500008
T4SS name [ID]VirB [394]
Gene symbol-
Locus tagDd586_1460
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]1658915..1659190 [-]
ProductConjugal transfer protein TrbC
Component typeVirB2
UniProt IDD2BWU4
KEGG IDddc:Dd586_1460
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 6.2e-15, Aligned region: 6..87
Protein Sequence: 91 a.a.     [Download]
>gi|271500008|ref|YP_003333033.1| Conjugal transfer protein TrbC [Dickeya dadantii Ech586]
MQKRKYLPAFFPAFISGQALAAGSGFTKANDTLSNTSTGLLGLAAVTITLATMWVGYKVLFDGKSLHDMR
NVIIGAILIVGASGFGAYWAS
 
Nucleotide Sequence: 276 bp     [Download]
>gi|271498578|ref|NC_013592.1|:c1659190-1658915 Dickeya dadantii Ech586 chromosome, complete genome
ATGCAAAAACGTAAATACTTACCGGCCTTTTTCCCCGCCTTCATTTCCGGCCAGGCGCTAGCGGCAGGCA
GCGGATTTACCAAAGCCAACGACACGCTGAGCAACACGTCAACCGGTCTGCTGGGGCTGGCCGCCGTCAC
CATCACACTGGCCACCATGTGGGTGGGTTACAAGGTGCTGTTTGACGGTAAAAGCCTGCATGACATGCGC
AACGTCATCATCGGGGCCATCCTGATCGTCGGCGCATCCGGCTTTGGCGCGTACTGGGCATCCTAG
 Primer design