SecReT4
Protein ID: 271501186
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2664
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]2997519..2998226 [+]
ProductLytic transglycosylase catalytic
Component typeVirB1
UniProt IDD2C3C5
KEGG IDddc:Dd586_2664
PDB IDNA
Domain hit(s) vs Pfam SLT [PF01464], Evalue: 5.9e-22, Aligned region: 9..142
Protein Sequence: 235 a.a.     [Download]
>gi|271501186|ref|YP_003334211.1| Lytic transglycosylase catalytic [Dickeya dadantii Ech586]
MLSTTAFLAAAMQCAASIHPSTALDVARVESGFNPYAIAEIIPKATRSLGDNNVISHQPASREKAEHIIR
RLMAQGRRYSVGLMQITSTNFHHYGVTASDLLDPCTNLSVFERILSDCYQRGGSLKRALSCYYSGNFRTG
QQPEAAFSGTSYVQRIGYVSASPRYAVPGTRADKSTTPTPLEAIPVDKPSPPRLIWPGTVVRGVPAKLRQ
GKTAIAQTSAPSVRRSLSQSPREEE
 
Nucleotide Sequence: 708 bp     [Download]
>gi|271498578|ref|NC_013592.1|:2997519-2998226 Dickeya dadantii Ech586 chromosome, complete genome
ATGCTTTCCACCACTGCCTTTCTGGCGGCGGCCATGCAGTGTGCCGCCAGCATTCATCCGTCCACTGCAC
TCGACGTGGCACGGGTGGAATCCGGTTTTAACCCTTATGCCATCGCCGAAATTATTCCGAAGGCCACTCG
CTCCCTCGGAGATAACAATGTTATCTCCCATCAGCCCGCCAGCCGGGAAAAAGCTGAGCATATTATTCGC
CGCCTTATGGCACAGGGACGCCGTTACTCTGTGGGGCTGATGCAAATCACCAGCACCAATTTCCATCATT
ACGGCGTGACGGCCTCTGACCTGCTTGATCCCTGCACCAATTTGTCCGTTTTTGAACGCATTCTCAGCGA
CTGCTACCAACGTGGCGGTTCCCTGAAAAGGGCGCTGAGCTGCTATTACTCCGGCAATTTCCGTACCGGA
CAACAACCTGAAGCGGCATTTTCCGGGACCAGCTACGTGCAGCGGATAGGTTATGTTTCGGCATCTCCCC
GTTATGCCGTACCGGGCACCCGCGCGGATAAATCCACAACGCCGACTCCCCTCGAAGCCATCCCTGTTGA
TAAGCCATCCCCTCCCCGTCTGATCTGGCCGGGGACCGTTGTTCGGGGCGTCCCCGCAAAACTCCGTCAG
GGGAAAACCGCCATCGCACAAACCTCCGCGCCGTCAGTGCGCCGGAGCCTCTCCCAGTCACCCCGTGAGG
AAGAATAA
 Primer design