SecReT4
Protein ID: 271501187
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2665
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]2998226..2998519 [+]
ProductConjugal transfer protein TrbC
Component typeVirB2
UniProt IDD2C3C6
KEGG IDddc:Dd586_2665
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.3e-18, Aligned region: 3..94
Protein Sequence: 97 a.a.     [Download]
>gi|271501187|ref|YP_003334212.1| Conjugal transfer protein TrbC [Dickeya dadantii Ech586]
MILFRKLKTAVSAVSAGVLMVFSTTPAFADGFTRANTVMEKVSTGLHGLAAITITVAVIWVGYKTLWKGE
SLSQCAYIIIGGILIGGGSEIGALLMS
 
Nucleotide Sequence: 294 bp     [Download]
>gi|271498578|ref|NC_013592.1|:2998226-2998519 Dickeya dadantii Ech586 chromosome, complete genome
ATGATACTTTTTCGCAAGCTAAAGACCGCTGTCAGTGCTGTTTCCGCAGGTGTGCTCATGGTTTTTTCTA
CTACCCCGGCGTTTGCCGATGGTTTCACTCGCGCAAACACCGTGATGGAGAAAGTCTCCACCGGTCTTCA
TGGTCTGGCGGCCATCACCATCACCGTGGCCGTGATCTGGGTGGGTTACAAGACGCTCTGGAAAGGCGAA
AGCCTGTCCCAGTGCGCCTACATCATTATTGGCGGGATCCTGATTGGTGGAGGCAGTGAGATCGGCGCAC
TGCTGATGAGCTGA
 Primer design