SecReT4
Protein ID: 271501188
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2666
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]2998530..3001274 [+]
ProductCagE, TrbE, VirB component of type IV transporter system
Component typeVirB4
UniProt IDD2C3C7
KEGG IDddc:Dd586_2666
PDB IDNA
Domain hit(s) vs Pfam CagE_TrbE_VirB [PF03135], Evalue: 8.7e-48, Aligned region: 271..472
AAA_10 [PF12846], Evalue: 2.7e-26, Aligned region: 535..824
VirB3 [PF05101], Evalue: 9.6e-08, Aligned region: 4..81
Protein Sequence: 914 a.a.     [Download]
>gi|271501188|ref|YP_003334213.1| CagE, TrbE, VirB component of type IV transporter system [Dickeya dadantii Ech586]
MAKLLKAMKRPAALWGVPMVPLLGVTGITIIAAVWTSVAFLALLPVEFLVMKSVTRNEPMRFSLIAVWLR
ARGKPAANRLFGATVFMPVKHDAVDITEFLNAMKLNQCATLRKYIPYSSHIHQHVVRSPHSDLYCTWELT
GTPFDCESEETLNIDRNQLHGLIRSFEGMPVTFYIHNVREPFTDSLHKTSDNPYADEISRLYYASLAADP
FRRNRLFLTVCYRPFVSLEKAGRRRMNDGKKLKELDAALREMLEIKESLDTALSRYAARPLGTFTEDHAV
FSSQLSFYEYLLTHQWRRVRVTRAPAYSMMGSAALFFSGESGQINHASGTQYFRGLEVKEFPEETATGMM
DSLLYAPCDYIITQSYTCMSREEARKAIKRTRRLLMSSDDDAVSQRLDLDVALDLLTSGKIAYGKHHFSI
MVFSRSLDSLVADTSEISNALNNLGITPVPAALSLSAAYMAQLPGNYHLRPRKGELSSQNFVELAALHNF
YPGKRDNAPWGDAMALLRTPSGDGYYLNLHNTLADKDEFNEKNPASTCILGTNGSGKTMLMTFLENMQQK
YGRTDSFSPDAKTKRLTTVYLDKDRGAEMNIRALGGRYYRITHGDPTGWNPFSLLPTKRNISFISQLMKL
LCTRNGATITPRDERRLNDAVMAVMSNEPQYRIYGITRLLENLPEPATREAQENGLSIRLSQWAQGGEFG
WVFDNASDTFDISRCDNFGIDGTEFLDDANVCAPISFYLLYRITTLLDGRRLVIFMDEFWKWLRDPIFKD
FAYNRLKTIRKLNGMLVVGTQSPAEIIRDEIAPAVIEQCGTQILAANPSADRAHYVDGMKFEPEVFDVVK
NLDPQARQYVVVKNQFRRGDTKRFAARVTLDLSGVGRYTRVMSGSADNLEIFDSLYREGMQPHEWLEPYL
AQAL
 
Nucleotide Sequence: 2745 bp     [Download]
>gi|271498578|ref|NC_013592.1|:2998530-3001274 Dickeya dadantii Ech586 chromosome, complete genome
ATGGCAAAGCTGCTCAAAGCAATGAAGCGCCCGGCGGCACTGTGGGGAGTGCCGATGGTGCCCCTGCTGG
GTGTCACCGGTATCACCATCATCGCCGCTGTCTGGACTTCCGTCGCTTTCCTTGCCCTGCTCCCGGTTGA
ATTTCTGGTAATGAAGTCTGTCACCCGGAATGAACCCATGCGGTTCAGCCTGATTGCCGTCTGGCTCAGG
GCAAGAGGAAAACCGGCAGCAAACCGGCTGTTTGGCGCAACAGTATTTATGCCCGTCAAGCATGATGCTG
TTGATATCACGGAGTTTCTCAACGCCATGAAACTGAATCAATGTGCCACGCTCAGGAAGTACATTCCGTA
TTCATCGCATATTCATCAGCATGTTGTTCGCTCACCACACAGTGATCTCTACTGCACCTGGGAACTGACG
GGGACCCCGTTCGATTGCGAATCAGAAGAAACCCTCAATATTGACCGCAACCAGCTGCACGGACTCATCC
GCTCATTCGAGGGGATGCCGGTCACCTTTTATATCCATAATGTGCGGGAGCCGTTTACCGATTCGCTGCA
TAAGACATCCGACAACCCTTACGCCGATGAAATCAGCCGTCTGTATTATGCCTCGCTGGCGGCGGACCCA
TTTCGCCGTAACCGCCTGTTCCTGACCGTCTGTTACCGTCCATTTGTCAGTCTGGAAAAAGCCGGGCGCA
GACGCATGAATGACGGCAAGAAACTGAAAGAGCTTGACGCTGCACTGCGGGAAATGCTGGAAATCAAAGA
ATCGCTCGATACCGCACTGTCACGCTACGCCGCACGTCCTCTTGGCACGTTTACCGAAGATCACGCGGTA
TTCTCCTCCCAGTTATCCTTTTATGAGTACCTGTTGACGCACCAGTGGCGCAGGGTACGCGTCACCCGCG
CTCCGGCGTATTCAATGATGGGGTCGGCGGCGCTGTTCTTTTCTGGCGAGTCCGGGCAGATAAACCACGC
CAGCGGCACACAGTATTTCCGGGGGCTGGAGGTGAAGGAGTTCCCGGAGGAGACCGCGACAGGGATGATG
GACTCGCTGCTGTACGCCCCCTGCGATTATATAATTACACAGTCGTACACCTGCATGTCACGTGAAGAAG
CCCGCAAGGCCATCAAACGTACCCGACGTCTGTTAATGAGTTCAGATGACGATGCAGTGTCACAGCGACT
GGATCTGGATGTGGCGCTCGACCTGCTGACCTCGGGGAAAATCGCCTATGGAAAACACCATTTCTCCATC
ATGGTGTTTTCCCGCTCGCTGGACAGCCTGGTGGCCGATACCAGTGAAATCAGCAATGCCCTGAACAACC
TCGGCATTACACCGGTTCCCGCCGCGCTTTCTCTTTCAGCTGCGTATATGGCACAACTGCCCGGCAATTA
TCACCTGCGACCCCGGAAGGGAGAGCTGAGCAGTCAGAACTTTGTTGAGCTGGCCGCACTGCACAATTTC
TATCCCGGAAAGCGCGATAACGCGCCCTGGGGGGATGCGATGGCCTTGCTGCGCACCCCGTCAGGGGATG
GCTACTATCTGAACCTGCATAACACGCTGGCGGACAAGGACGAGTTCAACGAGAAGAACCCGGCCAGTAC
CTGCATTCTCGGCACCAACGGTTCGGGTAAAACCATGCTGATGACGTTCCTTGAAAACATGCAGCAGAAA
TACGGCCGTACGGACAGTTTTTCTCCTGATGCAAAAACCAAACGACTGACCACCGTTTATCTGGACAAAG
ATCGGGGCGCGGAAATGAATATCCGGGCGCTGGGAGGTCGTTACTATCGCATCACGCATGGCGACCCCAC
GGGTTGGAACCCGTTTTCGCTGTTGCCCACCAAACGCAATATCAGTTTCATCAGTCAGTTGATGAAACTG
CTGTGTACACGTAACGGCGCGACCATCACGCCCCGTGATGAACGCCGCCTGAATGACGCCGTGATGGCGG
TGATGAGTAATGAACCACAATATCGCATCTATGGGATCACCCGTTTACTGGAGAATTTACCTGAGCCTGC
CACCCGGGAGGCACAGGAGAATGGCCTGAGTATTCGCCTGTCGCAGTGGGCGCAGGGTGGCGAGTTTGGT
TGGGTGTTTGATAACGCCTCAGACACTTTCGATATCAGCCGTTGCGATAACTTTGGCATTGACGGCACAG
AGTTTCTCGATGATGCCAATGTCTGTGCGCCGATCTCCTTTTACCTGCTGTATCGCATCACCACGCTGCT
CGACGGAAGACGACTGGTTATCTTCATGGATGAGTTCTGGAAATGGCTGCGGGATCCGATCTTTAAGGAT
TTCGCCTATAACCGACTGAAAACCATCCGTAAACTCAACGGGATGCTGGTTGTGGGCACCCAGTCCCCGG
CGGAGATCATCAGAGATGAGATTGCGCCCGCCGTTATTGAGCAGTGCGGCACGCAGATCCTGGCAGCCAA
CCCCAGTGCCGACCGGGCGCACTATGTTGACGGGATGAAGTTTGAACCGGAAGTGTTCGATGTGGTGAAA
AACCTGGATCCGCAGGCCCGCCAGTATGTGGTAGTGAAAAATCAGTTCAGGCGTGGCGACACAAAACGTT
TTGCTGCACGCGTGACGCTCGACCTCTCCGGTGTCGGCAGATACACCCGAGTGATGAGCGGCAGCGCCGA
TAACCTCGAAATCTTTGATTCCCTGTACCGTGAAGGGATGCAGCCCCATGAATGGCTGGAACCCTACCTG
GCTCAGGCACTCTGA
 Primer design