SecReT4
Protein ID: 271501189
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2667
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3001295..3001999 [+]
Producttype IV secretion system family protein
Component typeVirB5
UniProt IDD2BRW2
KEGG IDddc:Dd586_2667
PDB IDNA
Domain hit(s) vs Pfam T4SS [PF07996], Evalue: 4.5e-39, Aligned region: 22..213
Protein Sequence: 234 a.a.     [Download]
>gi|271501189|ref|YP_003334214.1| type IV secretion system family protein [Dickeya dadantii Ech586]
MKRRFHALIFACVIASPLAHAGIPVLVDADPLRELEWLKETQRWMQTAQHYQSQIQAYKNQLATATGVRD
VADFVDQAKSLKSDLEKMRKPGQTLNDLLLSGGTSGQFDALYAKYRVFDTCNAEQSGRYADTCKQLVINK
AIQLEQTDEIQDQVSQTLGEINGLSNRIALSKDSKESQDLANSIQLKSVMLNTLTDQWEMSVKAAEKREK
VLEDVRIKQWNQQQLTSPTPDLNG
 
Nucleotide Sequence: 705 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3001295-3001999 Dickeya dadantii Ech586 chromosome, complete genome
ATGAAAAGGCGTTTTCATGCCCTGATTTTCGCGTGCGTCATTGCCAGCCCGCTGGCACATGCCGGTATTC
CTGTCCTTGTTGATGCTGACCCGCTGCGTGAGCTCGAATGGCTGAAAGAAACGCAGCGCTGGATGCAGAC
CGCGCAACATTATCAAAGCCAGATCCAGGCCTATAAAAATCAGTTAGCGACGGCCACCGGCGTCCGGGAT
GTTGCAGACTTTGTGGATCAGGCGAAGAGTCTGAAATCGGATCTGGAAAAAATGCGCAAACCCGGCCAGA
CACTCAATGACCTGCTACTTTCCGGCGGCACCTCAGGACAGTTCGATGCGCTGTACGCGAAGTACCGGGT
TTTCGATACCTGCAATGCCGAACAGTCAGGACGCTATGCTGATACCTGCAAACAGCTGGTCATCAATAAG
GCGATCCAGCTTGAGCAGACTGACGAGATCCAGGATCAGGTCAGCCAGACGCTGGGCGAGATTAACGGCC
TCTCGAACCGTATCGCACTATCCAAAGACTCAAAGGAGTCTCAGGACCTTGCCAACAGTATTCAGCTAAA
ATCAGTGATGCTGAACACGCTCACTGACCAGTGGGAAATGAGCGTGAAGGCAGCAGAAAAGCGCGAAAAA
GTCCTTGAAGATGTGCGTATTAAACAGTGGAATCAGCAACAGTTAACTTCGCCAACCCCTGATTTAAACG
GCTAA
 Primer design