SecReT4
Protein ID: 271501191
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2669
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3002246..3003310 [+]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeVirB6
UniProt IDD2BRW4
KEGG IDddc:Dd586_2669
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-49, Aligned region: 40..259
Protein Sequence: 354 a.a.     [Download]
>gi|271501191|ref|YP_003334216.1| TrbL/VirB6 plasmid conjugal transfer protein [Dickeya dadantii Ech586]
MPGGVFIGVEKHLIGGVTDATKGLMMSYSSMMVGLAATSATLYIMWRGYQILAGKLSTPMEDVTWDIMRM
AIILSFVANVSGYLDGVIDAINGLKEGFSGSDNIWQLLDSLWGKAKVLGKTLHDMDNSTYVKDEGMTAQF
YVWLGIFVLMIITAFISMIAEVMVLLLSITAPVFIFCLLYGFLRPMFNNWLQNVFAAILTVLFSALSLRI
VVNYLNSRLDIATQLSAQSNIVELGAQVCLAGVCAAILVYLSAKLASALAGASATVSMQGLAAVGIGAAA
FGAGKVAAGAGKQTTRTLQDNIQGWRDASAGKPGSGPGYSAAQARKNAIEQMIARNEARRLARSRETAVQ
KFHR
 
Nucleotide Sequence: 1065 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3002246-3003310 Dickeya dadantii Ech586 chromosome, complete genome
ATGCCCGGTGGTGTATTTATCGGTGTTGAAAAACACCTGATAGGAGGAGTTACTGACGCCACAAAGGGAC
TGATGATGTCATACTCCTCCATGATGGTGGGGCTGGCGGCAACGTCAGCCACGCTCTATATCATGTGGCG
TGGATACCAGATCCTGGCAGGTAAGTTGTCCACACCAATGGAGGATGTCACGTGGGACATCATGAGGATG
GCAATCATCCTGTCTTTTGTGGCAAATGTCAGCGGTTATCTCGATGGGGTGATAGATGCCATTAATGGCC
TGAAGGAGGGATTTTCCGGCAGCGATAATATCTGGCAGTTACTGGATAGCTTATGGGGTAAAGCGAAGGT
ATTGGGTAAAACGTTACACGACATGGATAACTCAACCTATGTAAAAGATGAGGGTATGACGGCTCAATTT
TATGTCTGGCTCGGCATATTCGTTTTAATGATTATCACCGCCTTTATTTCGATGATCGCGGAAGTCATGG
TTTTACTGCTGAGTATTACCGCCCCCGTGTTTATCTTTTGTCTGCTGTATGGCTTTTTACGCCCCATGTT
TAACAACTGGCTGCAGAATGTTTTCGCCGCCATATTAACGGTTCTGTTTTCTGCGTTGTCGCTACGTATT
GTCGTTAATTATTTAAACTCGCGGTTAGATATTGCAACACAACTGTCTGCACAATCCAACATTGTAGAGC
TAGGCGCACAGGTCTGTCTGGCCGGTGTCTGTGCTGCAATACTGGTCTACCTCTCCGCAAAACTGGCCAG
CGCGCTGGCCGGGGCCAGTGCAACCGTGTCCATGCAGGGGCTGGCGGCGGTGGGTATCGGCGCGGCGGCG
TTTGGTGCCGGGAAAGTGGCAGCAGGAGCCGGTAAGCAGACTACCCGCACCCTTCAGGATAATATCCAGG
GCTGGAGGGATGCCAGTGCGGGTAAACCCGGCAGCGGTCCGGGATACAGCGCAGCTCAGGCACGTAAGAA
TGCGATTGAGCAGATGATTGCCCGCAACGAAGCCCGAAGACTGGCGCGATCAAGAGAAACGGCCGTTCAG
AAATTCCATCGTTAA
 Primer design