SecReT4
Protein ID: 271501193
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2671
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3003524..3004207 [+]
ProductVirB8 family protein
Component typeVirB8
UniProt IDD2BRW6
KEGG IDddc:Dd586_2671
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-49, Aligned region: 10..222
Protein Sequence: 227 a.a.     [Download]
>gi|271501193|ref|YP_003334218.1| VirB8 family protein [Dickeya dadantii Ech586]
MSEQTLIADSRTFEQQMIERDKRATKAGFMVGGAGLLTAVMALTAVVLMLPLKQTVVELYTVDNHTGRVE
HVTRASKTSLTAEAAYQKAMTSGYVRLRERYVYPSLQDDYATVQVYNSPQVNDDYLALYAGKDAPDKVYQ
NGTNTVRIDILSNQITSGTDPDKVATLRYKKTIRRLADNSTRTEYWDARLTFHSDPGREMSDTEREVNPF
GFTVTSWQADREIRGGE
 
Nucleotide Sequence: 684 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3003524-3004207 Dickeya dadantii Ech586 chromosome, complete genome
ATGAGTGAACAGACCCTCATTGCGGATTCCCGCACCTTTGAACAGCAGATGATTGAGCGGGACAAACGTG
CCACAAAAGCCGGGTTTATGGTGGGCGGTGCGGGCCTGCTCACCGCCGTAATGGCGCTTACCGCCGTGGT
GCTGATGCTGCCCCTGAAACAGACGGTCGTTGAACTGTACACTGTGGATAATCATACCGGACGAGTCGAG
CACGTCACCCGTGCATCGAAAACCAGTCTGACGGCGGAGGCGGCTTATCAGAAGGCGATGACGTCCGGTT
ACGTCAGGCTGCGTGAACGCTATGTTTACCCTTCTCTGCAGGACGATTACGCCACGGTACAGGTTTATAA
CAGCCCTCAGGTCAACGATGACTATCTGGCGCTGTATGCCGGAAAAGATGCCCCGGACAAGGTGTACCAG
AATGGGACAAATACCGTACGGATCGACATTCTGTCAAACCAGATCACCTCAGGCACGGATCCCGATAAAG
TTGCCACCCTCCGTTACAAAAAGACCATCCGCCGCCTCGCAGACAACAGCACCCGCACCGAATACTGGGA
TGCCCGCCTGACATTTCACTCCGACCCCGGCAGAGAAATGAGCGATACGGAGCGGGAGGTTAACCCGTTC
GGTTTTACCGTGACCAGTTGGCAGGCAGACCGTGAAATCCGGGGAGGTGAATAA
 Primer design