SecReT4
Protein ID: 271501194
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2672
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3004207..3005112 [+]
ProductP-type conjugative transfer protein VirB9
Component typeVirB9
UniProt IDD2BRW7
KEGG IDddc:Dd586_2672
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 7e-54, Aligned region: 29..275
Protein Sequence: 301 a.a.     [Download]
>gi|271501194|ref|YP_003334219.1| P-type conjugative transfer protein VirB9 [Dickeya dadantii Ech586]
MKSITLIPLALMMCGTAWCAAIPQASRYDARVQQVVYNPLNVTVVSTRPGFMTTLVFDSDEAVISARPGF
EEAWEATPDANRVNVRPVALVQGAPGADGNTTQVVIPPNSQDWHTNLLIVTTRRLYNVELNVIDDKSPQQ
PAFQVSYRYPGEAQEKASRETAARMREQEQKQQQADIQQALNAAQTPRNWDYLKYPGRDSTRIVPDFAYD
DGRFTFVGFSPAKSIPSVTKELNGQEHVVNSSIRRKGNFTVLVIQEVTPRLVLRSGNAVVGLENRGFGKV
QAADGATVSPYVERVEKPATH
 
Nucleotide Sequence: 906 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3004207-3005112 Dickeya dadantii Ech586 chromosome, complete genome
ATGAAAAGCATCACTCTTATCCCGCTGGCGCTCATGATGTGTGGCACGGCATGGTGCGCGGCCATCCCGC
AGGCCAGCCGCTATGATGCCCGCGTTCAGCAGGTTGTCTATAACCCACTGAACGTTACTGTCGTCAGCAC
CCGGCCCGGCTTCATGACCACGCTGGTCTTTGACAGCGACGAAGCGGTTATCAGCGCCAGACCCGGTTTT
GAAGAAGCGTGGGAAGCCACACCGGACGCCAACCGGGTCAACGTCCGCCCGGTGGCGCTCGTTCAGGGCG
CGCCCGGCGCGGACGGTAACACCACGCAGGTGGTGATCCCCCCTAACAGCCAGGACTGGCATACCAACCT
GCTGATCGTCACCACCCGTCGGCTCTACAACGTCGAGCTGAACGTCATCGATGATAAGTCACCGCAGCAG
CCCGCTTTCCAGGTGAGTTACCGTTATCCGGGTGAAGCACAGGAAAAGGCCAGCCGTGAGACAGCGGCCA
GAATGCGGGAGCAGGAGCAAAAACAGCAGCAGGCTGACATTCAGCAGGCCCTGAATGCCGCACAGACGCC
ACGCAACTGGGACTACCTCAAATATCCGGGGCGCGACAGCACCCGTATCGTGCCGGATTTCGCGTATGAC
GATGGCCGCTTTACGTTCGTGGGCTTCTCCCCGGCCAAATCTATTCCCTCCGTGACAAAGGAGCTGAACG
GCCAGGAGCATGTGGTTAACAGCAGTATCCGCAGAAAAGGCAACTTCACCGTATTGGTTATTCAGGAGGT
CACGCCCCGTCTGGTCCTGCGTTCCGGTAACGCCGTGGTCGGTCTGGAAAATCGTGGTTTCGGTAAGGTC
CAGGCCGCTGATGGTGCCACGGTTTCACCGTATGTCGAACGGGTGGAAAAGCCCGCAACCCATTGA
 Primer design