SecReT4
Protein ID: 271501195
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2673
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3005132..3006373 [+]
Productconjugation TrbI family protein
Component typeVirB10
UniProt IDD2BRW8
KEGG IDddc:Dd586_2673
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 2.2e-49, Aligned region: 217..402
Protein Sequence: 413 a.a.     [Download]
>gi|271501195|ref|YP_003334220.1| conjugation TrbI family protein [Dickeya dadantii Ech586]
MNDEHPHPVPDGSVPSPAQRDNDIATLEREARARRETALLTAQDDEEDDPLQPAVNKLKKRRRGKATAFL
AIAAVALIALAWAGNWVYRNLLWQPGEEKRQDAKPQPNRSDYRQRTDLGTQDTGAEASEPAENSPHMTTA
PEPEMPPQLDKAHFLVRRDGSAAAAQNPVRTRQQEMSQATSDMQQSGTSSTDQQNTTAPPPEPSPAAVRR
IPYNPDLYVPENTAIPCSLDYRFVSDRAGEIRCTIADDIWSASGNTKLIEKGTTATGIYQTGAETGMTHG
QGRAFLIITKLRTRQPPYLDIPLVDTRAAGGLGEAGVDGWIDTHFRERFGGALLVGMIPDIGAWASNSVG
QKDRNTDYTENSRQAMADMARTTLENSINIPPTLYKNQGEIINLITGQDIDFSGIYTLRMKSE
 
Nucleotide Sequence: 1242 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3005132-3006373 Dickeya dadantii Ech586 chromosome, complete genome
ATGAACGATGAACACCCGCATCCGGTGCCTGATGGCTCAGTGCCTTCTCCGGCACAACGAGATAATGATA
TTGCCACGCTGGAGCGCGAGGCCCGAGCAAGGCGGGAAACGGCGCTTCTCACCGCGCAGGACGATGAAGA
GGACGATCCGCTACAACCCGCCGTCAACAAACTGAAAAAGCGCAGGCGCGGGAAAGCCACCGCGTTTCTG
GCGATCGCCGCCGTTGCGCTGATTGCGCTGGCATGGGCGGGCAACTGGGTATACCGCAATCTGCTCTGGC
AACCCGGTGAAGAGAAGCGGCAGGATGCTAAGCCACAGCCGAACAGGAGCGATTACCGGCAGCGTACCGA
TCTGGGTACGCAAGATACCGGAGCCGAAGCATCGGAACCGGCAGAAAACAGCCCGCACATGACGACAGCC
CCGGAGCCTGAGATGCCGCCTCAACTTGATAAAGCCCATTTTTTGGTTCGGCGCGATGGTTCAGCCGCTG
CGGCCCAAAACCCGGTACGGACCCGGCAGCAGGAGATGTCGCAGGCAACCTCTGACATGCAACAGTCAGG
AACGTCATCCACTGATCAGCAAAACACCACCGCGCCACCACCGGAACCCTCCCCTGCAGCAGTTCGGCGT
ATTCCTTACAATCCGGACCTGTACGTCCCGGAAAATACCGCTATTCCCTGCTCACTGGATTACCGCTTTG
TTTCGGATCGGGCGGGGGAAATCCGCTGCACGATCGCCGACGATATCTGGAGTGCCAGCGGTAATACCAA
ACTGATTGAAAAAGGGACCACCGCAACGGGCATTTACCAGACGGGTGCGGAAACCGGGATGACGCACGGA
CAGGGACGCGCCTTTCTCATCATCACAAAGCTGCGTACTCGCCAGCCCCCTTATCTTGATATTCCGCTGG
TCGATACCCGCGCTGCCGGAGGGCTCGGCGAGGCTGGCGTTGACGGCTGGATCGACACGCATTTCAGGGA
GCGATTCGGCGGCGCATTACTGGTTGGTATGATCCCTGATATTGGGGCATGGGCATCCAACAGCGTCGGT
CAGAAAGATCGTAATACGGACTATACCGAAAACAGTCGTCAGGCGATGGCAGATATGGCGCGAACCACGC
TGGAAAACAGCATCAATATCCCACCGACCCTCTACAAAAATCAGGGTGAGATCATCAATCTGATCACTGG
ACAGGATATTGATTTTTCCGGCATCTATACGCTGAGGATGAAGAGTGAATAA
 Primer design