SecReT4
Protein ID: 271501198
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2676
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3007728..3008747 [+]
ProductP-type DNA transfer ATPase VirB11
Component typeVirB11
UniProt IDD2BRX1
KEGG IDddc:Dd586_2676
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 7.6e-49, Aligned region: 16..277
Protein Sequence: 339 a.a.     [Download]
>gi|271501198|ref|YP_003334223.1| P-type DNA transfer ATPase VirB11 [Dickeya dadantii Ech586]
MKNISLDRYKQRFFGDFLDRRGLTEIAVNRPGELFTKIDGIWEQHTVPLDYEGCYNFARCLAKHHGDNIE
DIKPGLSATLESGERCQVIVPPACERNTVSITLRKPSQVQIPHQDYIAAGFYNRVTGTEKTQTHDQELLA
LYDAKDIPRFMEKCVEYGKTIAVAGETSTGKTTYMKMLIDYIPPHLRITTIEDNPEITLFIHKNYVHLFY
PSESADEKGSIVTPASLLRWNYRMNPDRILLTEVRGGEAWDFLKITGSGHEGSMTSIHAGSAMEAVDGFI
TRCYENPQCARLPYTFMLRKVLDSLDVIVSIDLDGNVRRMNDIYFRPLHRSAFFEEMKA
 
Nucleotide Sequence: 1020 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3007728-3008747 Dickeya dadantii Ech586 chromosome, complete genome
ATGAAAAACATCTCTCTCGACCGCTATAAGCAGCGATTTTTTGGCGATTTTCTGGATCGCCGAGGACTGA
CAGAGATCGCCGTCAACCGCCCGGGTGAGCTATTCACCAAAATTGATGGCATCTGGGAACAGCATACTGT
CCCGCTGGATTATGAGGGCTGCTACAACTTTGCCAGATGCCTAGCGAAGCATCACGGCGACAATATCGAA
GATATCAAGCCGGGGCTGTCAGCCACGCTGGAATCCGGCGAACGTTGTCAGGTTATTGTACCCCCGGCCT
GCGAGCGTAACACGGTGTCCATAACCCTGCGTAAACCCTCACAGGTGCAAATCCCGCATCAGGACTATAT
CGCCGCCGGGTTTTATAACCGGGTGACGGGCACGGAAAAAACGCAGACGCACGATCAGGAATTACTGGCT
TTATATGACGCAAAAGACATTCCGCGCTTTATGGAGAAATGTGTGGAATACGGTAAAACCATTGCGGTGG
CCGGGGAAACCAGTACCGGGAAAACCACCTATATGAAGATGCTGATTGATTATATCCCTCCTCATCTGCG
TATTACGACCATTGAAGATAACCCGGAAATCACCCTATTTATCCATAAAAACTACGTCCACCTTTTTTAT
CCGTCGGAATCGGCAGATGAAAAAGGGTCAATTGTGACGCCCGCCAGCCTGCTGCGCTGGAATTACCGTA
TGAATCCCGACCGCATACTATTAACCGAAGTGCGTGGCGGTGAGGCCTGGGATTTTCTCAAGATAACCGG
CTCCGGCCATGAAGGCAGTATGACCTCTATCCATGCCGGTTCAGCAATGGAAGCGGTAGACGGGTTTATT
ACCCGCTGTTATGAAAACCCGCAATGCGCCCGACTCCCTTACACCTTTATGTTACGCAAGGTACTGGACA
GTCTGGACGTTATCGTGAGTATCGACCTGGACGGTAATGTGCGCCGGATGAATGATATTTATTTCCGGCC
ACTGCACCGCAGCGCCTTTTTTGAGGAGATGAAAGCATGA
 Primer design