SecReT4
Protein ID: 271501202
T4SS name [ID]VirB [395]
Gene symbol-
Locus tagDd586_2681
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T4SS(s) in this replicon]
Location [Strand]3010556..3012415 [+]
Productputative MobB mobilization protein
Component typeVirD4
UniProt IDD2BRX5
KEGG IDddc:Dd586_2681
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 1.1e-09, Aligned region: 342..537
TrwB_AAD_bind [PF10412], Evalue: 6.6e-09, Aligned region: 401..542
TraG-D_C [PF12696], Evalue: 1.5e-05, Aligned region: 411..526
DUF87 [PF01935], Evalue: 9.6e-05, Aligned region: 176..275
Protein Sequence: 619 a.a.     [Download]
>gi|271501202|ref|YP_003334227.1| putative MobB mobilization protein [Dickeya dadantii Ech586]
MILNKLAASLSPIVNGMLALLAFMQQQQLMLALLAGLTMPFFASMKSDERQKAPLWKKLIIAFSMLCFFS
GTLAPVIIGFFQWLYKTRLTSDNTVLAWSVRIAFTVTGMIFHIMFRRVFTPKLDRIKKSLVKKTTLERKL
RTDVRTVKSLLPKTLHYNPLDYIDLNKGIFTGMGRANEPIYLPLKDWQKQHADIIGTTGAGKGVAAGILL
YQSILAGEGVFVMDPKDDEWAPHLYRKSCEDAGKPFALIDLRKQQYQLNLIEDITPNELEELFVAGFSLA
EKGQESDFYRIDDRKAARMAAQFVSDNPSATLRDVYNGDYVQGIAEKIKAFFGKIEELALLNAINSPEGF
SLKKIFDKGGCCYVIGSMRNSKIITAQRMLLVRLYQLAERRDRVTDVPRPIAIYLSELKYLLSRPALEGL
GAARDKGVHIIMDHQSIADLKDCPADLKGEAVVGAVVENAKFKLVYRVMDPDTAEWVARMSGTILVDDEL
RKAKTDNMLTETIDSERTIRQAERFFIDSNMILNLPDFVSFIFTTKTLPSASLISPIKVRKRQLKIFSVS
PDIAAAAAPVKIMLDFCEDDKPAMSDVMTTHPALSIDENEVKPVKPKPDDEEHLSPLDF
 
Nucleotide Sequence: 1860 bp     [Download]
>gi|271498578|ref|NC_013592.1|:3010556-3012415 Dickeya dadantii Ech586 chromosome, complete genome
GTGATTTTGAATAAGCTGGCCGCTTCACTGTCGCCGATAGTGAACGGGATGCTGGCACTGCTCGCTTTTA
TGCAACAGCAACAACTGATGCTGGCATTATTAGCGGGACTGACGATGCCGTTTTTCGCGTCGATGAAAAG
CGATGAACGACAGAAAGCCCCGTTATGGAAAAAGCTGATTATCGCTTTTTCCATGCTGTGTTTTTTCTCT
GGCACACTAGCCCCGGTCATTATCGGCTTTTTTCAGTGGCTGTATAAGACCAGACTCACCAGCGATAATA
CGGTACTGGCCTGGTCAGTACGGATTGCTTTCACTGTAACCGGGATGATTTTTCATATTATGTTTCGCCG
GGTATTCACGCCGAAACTGGACAGGATAAAGAAAAGCCTTGTAAAAAAAACCACACTTGAACGGAAACTG
CGCACTGATGTCCGCACCGTAAAATCACTGCTGCCGAAAACTCTGCATTATAACCCGCTGGATTATATCG
ACCTGAATAAAGGCATTTTTACTGGCATGGGCAGGGCAAATGAACCGATTTATCTCCCGTTAAAAGACTG
GCAGAAACAACACGCGGATATTATCGGTACCACCGGAGCCGGTAAAGGGGTTGCCGCTGGTATTTTGCTT
TATCAAAGTATTCTGGCCGGTGAAGGTGTGTTTGTTATGGACCCCAAGGATGATGAATGGGCACCGCATC
TTTACCGGAAATCCTGCGAGGATGCAGGAAAACCCTTTGCCTTAATTGACCTGCGAAAACAGCAATACCA
GTTAAACCTGATTGAAGATATCACGCCCAATGAACTGGAAGAATTGTTTGTTGCCGGTTTCAGCCTGGCA
GAAAAAGGGCAGGAATCGGACTTCTATCGTATTGATGACCGAAAAGCCGCCCGTATGGCCGCGCAATTTG
TCAGTGATAACCCATCGGCAACTCTCCGTGATGTTTATAACGGTGATTACGTTCAGGGTATTGCCGAAAA
AATCAAAGCGTTCTTTGGGAAGATTGAGGAACTGGCGTTACTCAATGCCATTAACTCACCGGAGGGTTTT
TCACTCAAAAAAATATTTGATAAAGGTGGCTGCTGTTATGTTATCGGTTCCATGCGAAACAGCAAAATTA
TTACAGCCCAGCGCATGTTACTGGTTCGCCTGTACCAGTTAGCAGAAAGGCGCGACCGTGTAACAGACGT
ACCGCGCCCCATTGCTATTTATCTTTCCGAACTGAAATACCTTTTATCCAGGCCAGCACTGGAGGGATTA
GGTGCGGCGCGGGATAAAGGCGTACATATTATTATGGATCACCAGTCCATTGCCGATTTAAAAGACTGCC
CGGCAGATTTAAAAGGCGAGGCGGTTGTCGGCGCTGTGGTAGAAAATGCAAAATTCAAGCTGGTTTACCG
GGTTATGGACCCGGATACGGCGGAATGGGTGGCAAGAATGTCAGGCACGATTCTGGTGGATGACGAACTC
CGTAAAGCTAAAACGGATAATATGCTGACGGAGACCATCGACAGTGAGCGCACAATCCGCCAGGCCGAAC
GTTTCTTTATTGACAGCAATATGATCCTGAACCTGCCCGATTTTGTCAGCTTTATCTTTACGACAAAAAC
GCTACCTTCTGCCTCACTGATCTCGCCGATAAAGGTCAGAAAGCGTCAGCTAAAAATCTTTTCGGTTTCC
CCTGATATTGCCGCAGCGGCAGCCCCAGTGAAGATCATGCTGGATTTTTGCGAGGATGATAAACCAGCCA
TGTCGGATGTGATGACAACACACCCGGCTCTTTCCATCGACGAAAACGAAGTAAAACCGGTAAAGCCGAA
ACCTGATGATGAAGAACACCTCTCCCCGCTTGATTTTTAA
 Primer design