SecReT4
Protein ID: 27228603
T4SS name [ID]Tra_F [591]
Gene symboltrhN
Locus tagD786_p122
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]110463..113138 [+]
Productmating pair strabiliation protein
Component typeTraN_F
UniProt IDQ8GHT8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraN [PF06986], Evalue: 1e-52, Aligned region: 373..627
TraN [PF06986], Evalue: 1e-52, Aligned region: 734..810
Protein Sequence: 891 a.a.     [Download]
>gi|27228603|ref|NP_758653.1| mating pair strabiliation protein [Pseudomonas resinovorans]
MFPPCHSIEASLFLDMRSMRQPLKTTLIRLVNATVIGLYLNSMTFTAWADAVTAGSAAGQSVGQQALQVF
DGGNASVTLQDLFPDAGDTVSLEKVYGDDVKTIDLGLRANTRLKSESSSEGEAYRTLIDSGNRMSVDLSK
DPMLNQADKVRSPDFMDGFKQNFADCKSTDVFENVTKNAHVANYKTCERVVDQGGNVEFLHDYKVGVIEY
VSGQPNFQSCGRGCLYIWVGTVGDNYWGGNCAIYEEYTRFRVIAKDAIISATIDRAVFDDYFQILFNDQM
LWTHTPGVFPPETSGSCERGTSWNVAPNKVITDKFGSDDDVITFKTRTSVTGGGEGYARIKIIYDPAKAF
VDKGWGPEERLPMFDMIEDGFCTNAQMSCTSMPAVDANGCTETNGVQICRSDMPPSPHPNIDPLCKKAKV
SAECSYYKGNMDCYTDAKGVQRCPSNDGGNLNTCTQYEQNPSCGFISQGCIDGAKGETGACYAFEEVWDC
GYDTSYETIVNTGAQIECPGGARCMGSECFDSSNTKSGDFAYAVAMLQVAQFAEHDLDCGGDGTDINEAN
DCKVFKGEAMECKKALGGYVDCCEAPESVSIFDYVNLTMNTLKMTSSLEALNRTGSLFAPGYWAAGSNAV
MAAGTSVVKGQWGSIVDAATGAFEKTLSGTLEQTALSKLQTWLMQQAYDAMVDMGATAAADAVFATGADG
AVTGLGANAAMVVNIIGWVYMVYVIVDLLINIIWECEEKEFELGAKKETRQCHFVGSYCASEVLGSCVEK
REAYCCFGSVVARIIQESAREQLGLGWGEVKTPTCEGITPDQLGKMDWSRVDLSEWIGMLNLAGRLPTAS
TVSLEDVTGSGSGLGQFSEGTKRLNTLDRNLERLEGFDVDAVKKQYELDMK
 
Nucleotide Sequence: 2676 bp     [Download]
>gi|27228492|ref|NC_004444.1|:110463-113138 Pseudomonas resinovorans plasmid pCAR1, complete sequence
GTGTTTCCCCCTTGCCATAGCATCGAAGCATCCCTCTTTCTGGACATGCGATCGATGCGACAACCACTCA
AAACCACGCTCATACGCCTGGTCAACGCGACCGTCATAGGCCTATATCTCAATAGCATGACCTTCACTGC
TTGGGCTGACGCAGTGACCGCAGGATCGGCGGCGGGCCAATCGGTAGGCCAACAGGCACTTCAGGTTTTC
GACGGTGGGAATGCCTCGGTCACGCTCCAAGATCTTTTCCCTGACGCTGGCGATACGGTCTCGCTGGAGA
AGGTCTATGGCGACGATGTGAAGACGATTGATCTTGGGTTGCGGGCCAATACCCGTCTGAAATCGGAATC
GTCCTCTGAGGGGGAGGCATATAGAACGCTTATCGACAGCGGCAATCGCATGTCTGTAGATCTGTCCAAA
GACCCTATGCTCAACCAGGCTGATAAAGTTCGCTCGCCCGACTTCATGGACGGGTTTAAGCAAAACTTCG
CAGATTGCAAATCGACCGATGTATTTGAGAACGTGACGAAAAACGCCCACGTTGCTAACTACAAAACATG
TGAGCGTGTAGTGGATCAGGGCGGGAACGTTGAGTTCTTGCATGATTACAAGGTAGGTGTAATCGAATAT
GTTTCCGGGCAGCCAAACTTCCAGTCATGCGGTCGCGGCTGCTTGTATATCTGGGTCGGCACGGTCGGGG
ACAACTATTGGGGTGGTAACTGCGCGATCTATGAGGAGTACACCCGATTCCGCGTGATAGCTAAGGACGC
CATCATCTCAGCCACAATTGACAGAGCTGTTTTCGATGACTATTTCCAAATTCTGTTCAATGATCAGATG
CTTTGGACACATACACCAGGCGTTTTCCCACCTGAAACATCTGGCTCCTGCGAGCGTGGAACAAGCTGGA
ACGTAGCTCCGAACAAGGTGATCACTGACAAATTCGGCAGTGATGATGACGTGATTACGTTCAAAACTCG
CACCTCGGTCACCGGCGGTGGTGAGGGTTACGCCCGTATCAAGATCATTTATGACCCGGCAAAGGCGTTT
GTCGATAAAGGTTGGGGGCCGGAAGAGCGCCTGCCTATGTTCGACATGATCGAGGATGGGTTCTGCACCA
ACGCGCAGATGTCGTGCACGTCTATGCCGGCAGTGGATGCCAATGGCTGTACTGAAACCAATGGCGTTCA
GATCTGCCGCTCGGACATGCCACCATCCCCGCATCCGAACATCGATCCGCTTTGCAAAAAGGCCAAGGTA
AGCGCCGAGTGCTCTTACTACAAGGGCAATATGGATTGCTACACGGACGCCAAAGGTGTGCAACGGTGCC
CCTCAAATGATGGCGGTAACCTGAATACCTGCACCCAGTACGAGCAGAATCCAAGCTGCGGTTTTATCTC
TCAAGGCTGTATTGATGGCGCAAAAGGCGAGACAGGCGCTTGTTATGCCTTCGAGGAGGTCTGGGACTGC
GGTTATGACACCAGCTACGAAACAATCGTGAACACTGGTGCCCAAATCGAATGCCCTGGTGGGGCGCGGT
GCATGGGCAGTGAGTGTTTCGACTCGTCGAACACTAAAAGCGGCGATTTTGCCTATGCGGTGGCCATGCT
TCAGGTTGCTCAGTTTGCTGAGCACGACCTGGACTGCGGTGGTGATGGTACCGATATCAATGAGGCCAAT
GACTGCAAAGTGTTCAAGGGCGAGGCAATGGAGTGCAAAAAAGCACTCGGCGGTTACGTCGATTGTTGTG
AAGCGCCAGAAAGCGTATCCATCTTCGACTATGTGAACCTGACGATGAACACGCTCAAGATGACCAGTTC
GCTGGAAGCGCTGAACAGAACGGGTAGCCTGTTCGCGCCCGGATACTGGGCTGCGGGAAGTAACGCTGTG
ATGGCAGCTGGTACTTCGGTCGTGAAGGGGCAATGGGGGTCTATCGTGGATGCTGCTACAGGCGCATTCG
AGAAGACGCTCAGCGGCACCCTTGAGCAGACAGCCTTGAGTAAGCTGCAAACCTGGCTCATGCAACAGGC
ATATGACGCCATGGTGGATATGGGAGCGACCGCGGCAGCAGATGCTGTGTTTGCAACTGGGGCCGATGGC
GCAGTAACTGGTCTTGGGGCAAACGCTGCGATGGTGGTGAACATTATCGGCTGGGTGTATATGGTCTATG
TGATCGTAGATCTGCTGATCAATATCATTTGGGAATGCGAGGAGAAAGAGTTCGAGCTAGGGGCGAAAAA
GGAAACCCGACAATGCCATTTTGTTGGGAGCTACTGCGCTTCCGAAGTGCTTGGGTCTTGCGTTGAAAAG
CGCGAGGCGTATTGCTGCTTTGGCTCAGTTGTTGCGAGGATCATTCAGGAGTCGGCTCGTGAACAGCTAG
GGTTGGGATGGGGAGAGGTGAAAACCCCGACCTGCGAGGGGATCACACCCGATCAGTTGGGCAAAATGGA
TTGGTCGCGTGTGGATCTGTCCGAGTGGATTGGCATGTTGAATCTCGCAGGCAGACTGCCAACTGCTTCG
ACTGTTTCTCTTGAAGATGTAACGGGAAGCGGTAGTGGCTTGGGACAGTTTTCTGAGGGAACCAAACGCC
TGAATACCCTGGATCGCAACCTGGAGCGATTGGAGGGTTTCGACGTCGACGCGGTGAAGAAACAGTATGA
GCTTGATATGAAGTGA
 Primer design