SecReT4
Protein ID: 27228614
T4SS name [ID]Tra_F [591]
Gene symboltraI
Locus tagD786_p132
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]124079..126781 [+]
Productnickase
Component typeTraI_F
UniProt IDQ8GHS7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraI_2 [PF07514], Evalue: 6.5e-108, Aligned region: 109..429
Protein Sequence: 900 a.a.     [Download]
>gi|27228614|ref|NP_758664.1| nickase [Pseudomonas resinovorans]
MRRSKSRHSFSEPSGSNPSARHLPGFFSTIKLPENETQGGIPHASFSAHNMAEKRMPPFSFLKRLWPRSE
RALTDSFAHPAEQMITPEIKRYLENHNWRNLRYPPYQEGYPGLVSGQWFMRNYQHELFDRIIHSVGMPAS
DLKLYVEPILVNFAELAHMLPASENHHHSGPGGLLRHSLEVASLTLDGCLTTAFDTNETPARRSMRLRRW
YVAGIASGLLHDAGKPLTDIRATDFEGNNQWIYAQETLHDWSVRNKLTRYFLHWNSNRHGNHVQVSVAQA
TRIIPPAVQAWLIEGGHDIYEALLDAISGSGSSPLTELVKWADSASTKRDLNRGSNNGGGNATGVPVPRL
VSDAMLRLLSDGTWKINTPGGRVWVATDGIYIVWNQGAEEIVSMLVGDGVVAIPRSPDTLIGSLVEHGIA
ERAPNGDLYWLVTPHLLRKNGKGPALRCMKLVNPDILFPTTPIPPPVSIGLGKEGKQKDVIAPNDTAGAA
ANALSEHQEDLFGADLTGDSSGDTDADSGPTPPKESASSKPARKKKAAPRQAAPVPTTASSGVSLKQAQN
PVEDAPVNVDSESAADETAVIVSSQPEEALDAEEEEEAPQEPPASLEEMLLFLSPHSPAADPHQEETLSA
AEAEISSDLSDADPQAGPGQGAQELLPRQEKISLNSIMGQGKRTPKTTPPAESKKQKDGEVGRVAEEVPC
ASSILPADVVSKLTAHECYLLEQQPDLAQKLITATQDPENAALARNKVFVRLGKSSFLAEDIHPLVHAGW
LWQDITVEGPALTRTLQSREGFMLTADYSVIYCKLAELDWAIPHLSRLREADIPSLEQAVKSLIEKAVLE
EIGGSPVLSLTTYMLTNVAEQFGITSTSLENAVFCFRDAVKVAKRRKIFVRPLYEELPKK
 
Nucleotide Sequence: 2703 bp     [Download]
>gi|27228492|ref|NC_004444.1|:124079-126781 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGAGACGGTCGAAGAGCCGTCACAGTTTTTCGGAACCTTCTGGTTCTAACCCCTCAGCCCGGCACTTGC
CGGGCTTTTTTTCGACCATAAAACTGCCTGAAAACGAAACTCAAGGCGGTATCCCTCACGCATCATTCTC
AGCACACAACATGGCCGAGAAGCGTATGCCTCCATTTTCATTCCTGAAACGCCTGTGGCCTCGAAGCGAG
CGTGCCCTTACGGACAGCTTCGCGCATCCGGCCGAGCAGATGATTACTCCTGAGATCAAGCGGTACCTGG
AGAACCATAACTGGCGAAATCTTCGGTACCCACCCTACCAAGAGGGTTATCCAGGGCTGGTTAGCGGGCA
GTGGTTCATGCGCAATTATCAGCACGAACTGTTCGATCGGATTATTCATTCAGTCGGGATGCCTGCCAGT
GACCTCAAGCTCTACGTTGAGCCGATCCTGGTGAATTTCGCCGAATTGGCGCACATGCTGCCGGCGTCGG
AGAACCACCATCACTCCGGCCCAGGCGGATTGCTCCGACATAGCCTTGAGGTCGCCTCGCTCACCCTGGA
TGGGTGCCTTACTACAGCCTTTGATACAAACGAGACCCCGGCACGGCGAAGCATGCGCTTGCGTCGGTGG
TACGTCGCGGGCATCGCGTCGGGGCTGCTACACGACGCAGGGAAGCCACTCACAGATATTCGTGCCACCG
ATTTTGAAGGCAACAACCAGTGGATCTACGCGCAGGAAACACTTCATGACTGGTCTGTGCGCAACAAGCT
GACCCGCTATTTCCTGCATTGGAATTCCAATAGGCATGGGAATCACGTTCAGGTCTCTGTAGCGCAAGCA
ACACGGATCATTCCGCCAGCCGTACAGGCATGGCTGATTGAAGGTGGCCACGACATCTACGAAGCGCTCC
TCGATGCAATTTCCGGGAGCGGAAGCTCGCCTCTGACCGAGTTGGTCAAGTGGGCCGACTCTGCATCCAC
CAAGCGTGACCTCAATCGAGGCTCGAATAATGGCGGCGGCAATGCAACAGGTGTTCCGGTACCGCGGTTG
GTGTCGGATGCAATGCTGCGGTTGCTGAGTGACGGAACCTGGAAGATCAACACGCCTGGCGGCCGCGTAT
GGGTTGCAACTGATGGCATCTACATCGTTTGGAACCAGGGTGCCGAGGAGATTGTGAGCATGCTGGTCGG
TGATGGGGTTGTGGCCATCCCGCGATCACCTGACACGCTAATTGGTTCCTTGGTAGAGCACGGGATAGCA
GAGAGAGCCCCAAACGGCGACCTGTACTGGCTGGTTACGCCCCACCTTCTCCGCAAGAACGGCAAAGGCC
CGGCGCTGCGCTGCATGAAGCTTGTGAATCCGGACATCCTTTTTCCAACCACACCGATTCCGCCGCCAGT
TTCCATCGGCCTTGGGAAGGAGGGAAAGCAGAAGGATGTCATTGCTCCTAACGATACGGCTGGCGCAGCA
GCGAACGCGCTGAGTGAGCATCAGGAAGACCTGTTTGGGGCCGATCTAACTGGAGACTCGAGCGGGGATA
CTGACGCTGATTCGGGTCCTACACCTCCTAAAGAATCCGCATCGTCGAAGCCAGCAAGAAAGAAAAAAGC
GGCTCCAAGGCAAGCAGCTCCGGTACCAACAACCGCCTCTTCAGGGGTTAGCCTCAAACAAGCGCAGAAC
CCCGTCGAAGACGCCCCTGTTAATGTGGATTCAGAGTCGGCGGCTGACGAAACGGCGGTAATTGTTTCCT
CCCAACCAGAGGAAGCTTTGGATGCTGAGGAGGAGGAAGAAGCACCTCAGGAGCCACCTGCCAGCCTTGA
GGAAATGCTGCTTTTCTTGAGTCCTCACTCGCCGGCGGCTGATCCCCATCAAGAAGAAACACTCTCGGCC
GCTGAGGCTGAAATTAGCTCCGATCTCTCTGATGCTGATCCGCAGGCTGGACCAGGGCAAGGTGCGCAGG
AGCTTTTGCCTCGTCAGGAAAAAATTTCCCTCAACTCCATCATGGGGCAAGGCAAACGCACGCCTAAAAC
TACGCCTCCGGCGGAATCGAAGAAGCAGAAAGACGGAGAGGTCGGACGCGTCGCGGAGGAGGTGCCATGC
GCTTCCAGCATCTTGCCAGCCGATGTCGTCTCGAAGCTTACAGCGCACGAATGCTACCTGTTGGAACAAC
AACCTGATCTTGCCCAAAAGCTCATCACCGCGACTCAAGACCCCGAGAACGCGGCATTAGCAAGAAACAA
GGTATTCGTTCGACTGGGAAAATCTTCCTTCCTTGCTGAGGACATCCACCCGCTCGTCCATGCGGGCTGG
TTGTGGCAGGACATTACGGTCGAAGGTCCGGCCCTGACCCGGACCCTACAGTCCCGTGAAGGCTTCATGC
TCACTGCCGACTACAGCGTCATCTACTGCAAGTTAGCGGAGCTGGACTGGGCTATTCCTCACCTGTCGCG
GCTTCGTGAAGCCGACATCCCAAGCCTCGAGCAGGCTGTGAAGTCGCTGATCGAGAAGGCCGTACTTGAG
GAGATAGGCGGCTCACCTGTGCTCAGCCTCACAACCTACATGCTCACGAATGTCGCTGAGCAGTTCGGGA
TCACATCAACATCCCTAGAGAACGCGGTGTTCTGCTTCCGCGATGCCGTGAAGGTCGCCAAGCGCAGAAA
GATTTTCGTTCGCCCCCTTTACGAGGAGCTTCCCAAAAAATGA
 Primer design