SecReT4
Protein ID: 27228615
T4SS name [ID]Tra_F [591]
Gene symboltraG
Locus tagD786_p133
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]126778..128607 [+]
Productanchoring/coupling protein
Component typeTraD_F
UniProt IDQ8GHS6
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 5.8e-18, Aligned region: 161..533
TrwB_AAD_bind [PF10412], Evalue: 1.4e-15, Aligned region: 156..197
TrwB_AAD_bind [PF10412], Evalue: 1.4e-15, Aligned region: 443..564
TraG-D_C [PF12696], Evalue: 2.6e-14, Aligned region: 456..566
Protein Sequence: 609 a.a.     [Download]
>gi|27228615|ref|NP_758665.1| anchoring/coupling protein [Pseudomonas resinovorans]
MSEWDYTSYWRKNYEAREAVAWGSSMLAGTAVQLITEMPVTPYLITLGVQAGFALAAIPRALRVHRAKAC
LVGADLSFITLEEVIELVKRHPHEFYFGEAFPWRQRHGQYAFELQAMDIEAIIGKRGRRNAEVKGTKWIH
GIGMDEEEPCFRPADQRSIHHLVLGTTGAGKTRWFDLAISQCIARGEPVIVIDPKGDKGLAETCERTCRA
MGKASLFKYFHPAHPDKSVRLSLTKNYGRATEVASRVAVLMKSEAGDPFQAFAQMSLNSVIQAMLICNIL
PTLVGLRRTLEGDVPGLTIKVVMAFGSKVFGEDEFARMADSAILSAKVRNTEEKAKVLRKVYYNDIAKVE
ANTDLEGLLTMLEHERSHFSKMIAGLLPILVMLTSGEMGPLLSPHIDDEDPRRISDLNSVINADQVLYLG
LDSLADPMVGSTIGSLALADLASTAGEIYNHRLPKPVNIFVDEAAEVINDQLIQLLNKGRGAGINLYIAT
QTIADFKARMGDEAKAMQVLGNANNIICLRILDTDTQEFVAKKMTPTRYKYVMRTQGNSAGEGGVVQGGN
VGERLMQEEGERFPTALLGELPDLEYLAVFAGGDIRKGRLPILTGPTAN
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|27228492|ref|NC_004444.1|:126778-128607 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGAGTGAATGGGATTACACGAGTTACTGGCGGAAAAACTACGAGGCGCGGGAAGCTGTTGCGTGGGGTT
CTTCCATGCTTGCCGGTACCGCCGTTCAACTGATTACGGAGATGCCGGTAACCCCATACCTGATAACGCT
TGGCGTGCAAGCTGGATTCGCCCTGGCGGCCATACCAAGGGCCCTCCGTGTCCACCGGGCAAAAGCCTGT
CTCGTTGGAGCAGATCTATCCTTCATCACATTGGAGGAGGTGATCGAGCTGGTGAAGAGACACCCACACG
AGTTCTATTTCGGCGAGGCGTTCCCTTGGCGACAGCGGCACGGGCAGTACGCATTCGAGCTCCAGGCGAT
GGATATTGAGGCCATTATCGGTAAGCGTGGCCGCCGCAACGCTGAGGTTAAGGGTACGAAATGGATACAC
GGGATCGGTATGGATGAGGAGGAACCATGTTTCCGTCCAGCAGATCAGCGTTCGATCCACCACCTCGTCC
TGGGCACAACAGGGGCCGGTAAGACCCGCTGGTTCGACCTAGCTATATCTCAGTGTATTGCTCGTGGTGA
ACCCGTGATCGTAATCGATCCCAAAGGCGATAAAGGCCTAGCAGAAACGTGTGAGCGCACATGCAGGGCG
ATGGGGAAGGCCAGCCTGTTCAAATACTTCCACCCTGCACATCCGGACAAGTCGGTTCGTTTGTCGCTAA
CAAAGAACTACGGCCGGGCAACGGAAGTTGCCTCCCGTGTGGCAGTGTTGATGAAAAGCGAAGCCGGCGA
TCCATTCCAAGCCTTTGCTCAAATGTCCTTGAATAGCGTGATTCAGGCCATGTTGATCTGCAACATCCTG
CCCACGCTTGTTGGTCTCAGGAGAACCCTTGAGGGAGATGTTCCAGGGTTAACCATCAAGGTGGTCATGG
CCTTCGGTTCAAAGGTCTTCGGTGAAGATGAATTCGCGAGGATGGCCGATTCAGCAATTCTCTCGGCCAA
GGTTCGGAACACCGAAGAGAAGGCGAAGGTATTACGGAAGGTCTATTACAACGATATCGCGAAGGTTGAG
GCTAATACCGATCTGGAAGGTCTGCTCACCATGCTCGAGCACGAGCGATCGCACTTCAGCAAGATGATCG
CTGGCCTTCTTCCAATTCTGGTGATGCTCACCTCCGGTGAAATGGGGCCGCTGCTTTCCCCGCACATCGA
CGACGAAGACCCGCGCCGAATCAGTGACCTCAACTCGGTCATCAATGCCGACCAGGTTCTTTACCTGGGC
CTCGACTCGCTTGCCGACCCGATGGTGGGCTCAACCATCGGGTCGCTGGCCCTGGCCGATCTGGCGTCGA
CCGCGGGCGAGATCTACAACCACAGGTTGCCTAAGCCGGTGAACATCTTTGTCGACGAGGCCGCCGAGGT
GATCAATGACCAGCTCATCCAGCTGCTGAACAAGGGCCGCGGCGCAGGGATAAACCTCTACATCGCAACC
CAGACCATCGCCGACTTCAAGGCCCGCATGGGTGACGAAGCCAAGGCCATGCAGGTTTTGGGGAACGCGA
ATAACATCATCTGCCTCCGCATCCTTGATACCGATACGCAGGAGTTCGTGGCGAAAAAGATGACGCCAAC
TCGCTACAAATACGTGATGCGTACTCAGGGCAACTCGGCAGGTGAAGGCGGGGTGGTGCAGGGCGGGAAT
GTTGGTGAGCGCCTTATGCAAGAGGAGGGTGAGCGCTTCCCAACAGCGCTCCTCGGCGAGCTACCAGACC
TCGAATATCTCGCGGTGTTTGCGGGCGGTGATATCCGCAAGGGGCGACTACCCATTCTTACCGGCCCGAC
TGCCAACTGA
 Primer design