SecReT4
Protein ID: 27228619
T4SS name [ID]Tra_F [591]
Gene symboltrhL
Locus tagD786_p123
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]130488..130775 [+]
Productputative pillus assembly protein
Component typeTraL_F
UniProt IDQ8GHS2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 8.4e-18, Aligned region: 4..95
Protein Sequence: 95 a.a.     [Download]
>gi|27228619|ref|NP_758669.1| putative pillus assembly protein [Pseudomonas resinovorans]
MSEPIKIPAYIDQPPHVMFWRLDEVMPIGIGLVAGVLLAQLILCTVVGLLLARFYRRFCDNRPDGFLLHA
IYWHWGAIGRKRVRSMPNSYEREFV
 
Nucleotide Sequence: 288 bp     [Download]
>gi|27228492|ref|NC_004444.1|:130488-130775 Pseudomonas resinovorans plasmid pCAR1, complete sequence
GTGAGTGAGCCAATCAAAATCCCGGCATACATCGACCAGCCGCCTCACGTTATGTTTTGGCGTTTGGATG
AGGTGATGCCGATCGGAATCGGTTTGGTTGCCGGCGTTCTTCTGGCACAGCTGATTCTCTGCACGGTGGT
AGGTCTGTTGCTCGCTCGCTTCTATCGCCGCTTCTGCGACAACCGCCCTGACGGCTTTCTGCTTCACGCC
ATTTACTGGCACTGGGGAGCTATCGGCCGGAAGAGAGTGCGATCCATGCCCAATTCCTACGAGAGAGAGT
TCGTCTGA
 Primer design