SecReT4
Protein ID: 27228620
T4SS name [ID]Tra_F [591]
Gene symboltrhE
Locus tagD786_p125
StrainPseudomonas resinovorans plasmid pCAR1 (NC_004444)
Repliconplasmid pCAR1 [GenBank: NC_004444] [Browse all T4SS(s) in this replicon]
Location [Strand]130775..131413 [+]
Productputative pilus assembly protein
Component typeTraE_F
UniProt IDQ8GHS1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam TraE [PF05309], Evalue: 3e-12, Aligned region: 17..145
Protein Sequence: 212 a.a.     [Download]
>gi|27228620|ref|NP_758670.1| putative pilus assembly protein [Pseudomonas resinovorans]
MLLKSLSNSFDGMRGENQFLRIAVAGLVLSNLLVSCSALNKDEVVTVIPPTLTETAWVSKTQSSGEYADA
WALYIAMMLGNVTPHNASVVKDALGPILDKAIYQDTMKVLDTQIHQIRQDRVTLSFEPQKVLRDNLNENK
FYVTGRSVSEGPAGDKKRSNRTYEFELVIKDYKPVLSWLSTNSGDARTQDVVDRENSKAEKQAEREKRKK
NQ
 
Nucleotide Sequence: 639 bp     [Download]
>gi|27228492|ref|NC_004444.1|:130775-131413 Pseudomonas resinovorans plasmid pCAR1, complete sequence
ATGCTTTTAAAGTCGCTTAGCAATTCGTTTGATGGCATGCGCGGAGAAAATCAGTTTCTGCGCATTGCCG
TTGCTGGCCTTGTCTTGAGCAATCTGCTGGTGTCCTGCTCTGCTCTCAACAAGGATGAAGTGGTCACCGT
GATACCACCCACTCTGACTGAGACGGCCTGGGTCAGCAAAACGCAAAGTTCCGGTGAATACGCCGACGCA
TGGGCTCTGTACATCGCGATGATGCTGGGCAATGTCACCCCGCATAATGCCTCTGTAGTGAAGGATGCCC
TAGGTCCTATCCTCGATAAGGCGATCTATCAAGACACGATGAAGGTTCTCGATACCCAGATTCATCAGAT
CCGCCAGGATCGTGTGACCCTGAGCTTCGAGCCGCAGAAGGTGCTCCGCGATAACCTCAACGAGAACAAG
TTCTACGTTACCGGCCGCTCCGTTAGCGAAGGGCCGGCTGGCGATAAAAAGCGTAGCAACCGAACCTATG
AGTTTGAGCTTGTGATCAAAGACTATAAGCCAGTACTGAGTTGGCTCAGCACGAACTCTGGCGATGCTCG
AACTCAGGATGTGGTTGATCGCGAGAACAGCAAGGCCGAGAAACAAGCAGAGCGCGAGAAAAGAAAAAAA
AATCAGTAG
 Primer design